Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4520
Gene name Gene Name - the full gene name approved by the HGNC.
Metal regulatory transcription factor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MTF1
Synonyms (NCBI Gene) Gene synonyms aliases
MTF-1, ZRF
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p34.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a transcription factor that induces expression of metallothioneins and other genes involved in metal homeostasis in response to heavy metals such as cadmium, zinc, copper, and silver. The protein is a nucleocytoplasmic shuttling protein
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016162 hsa-miR-590-3p Sequencing 20371350
MIRT026986 hsa-miR-103a-3p Sequencing 20371350
MIRT028255 hsa-miR-32-5p Sequencing 20371350
MIRT051017 hsa-miR-17-5p CLASH 23622248
MIRT048354 hsa-miR-106a-5p CLASH 23622248
Transcription factors
Transcription factor Regulation Reference
ATM Unknown 12926986
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 9582278
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0000987 Function Cis-regulatory region sequence-specific DNA binding IDA 15735762
GO:0000987 Function Cis-regulatory region sequence-specific DNA binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600172 7428 ENSG00000188786
Protein
UniProt ID Q14872
Protein name Metal regulatory transcription factor 1 (MRE-binding transcription factor) (Transcription factor MTF-1)
Protein function Zinc-dependent transcriptional regulator of cellular adaption to conditions of exposure to heavy metals (PubMed:8065932). Binds to metal responsive elements (MRE) in promoters and activates the transcription of metallothionein genes like metallo
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 140 164 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 170 194 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 200 224 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 229 253 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 259 283 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 289 313 Zinc finger, C2H2 type Domain
Sequence
MGEHSPDNNIIYFEAEEDELTPDDKMLRFVDKNGLVPSSSGTVYDRTTVLIEQDPGTLED
EDDDGQCGEHLPFLVGGEEGFHLIDHEAMSQGYVQHIISPDQIHLTINPGSTPMPRNIEG
ATLTLQSECPETKRKEVKRYQCTFEGCPRTYSTAGNLRTHQKTHRGEYTFVCNQEGCGKA
FLTSYSLRIHVRVH
TKEKPFECDVQGCEKAFNTLYRLKAHQRLHTGKTFNCESEGCSKYF
TTLSDLRKHIRTH
TGEKPFRCDHDGCGKAFAASHHLKTHVRTHTGERPFFCPSNGCEKTF
STQYSLKSHMKGH
DNKGHSYNALPQHNGSEDTNHSLCLSDLSLLSTDSELRENSSTTQGQ
DLSTISPAIIFESMFQNSDDTAIQEDPQQTASLTESFNGDAESVSDVPPSTGNSASLSLP
LVLQPGLSEPPQPLLPASAPSAPPPAPSLGPGSQQAAFGNPPALLQPPEVPVPHSTQFAA
NHQEFLPHPQAPQPIVPGLSVVAGASASAAAVASAVAAPAPPQSTTEPLPAMVQTLPLGA
NSVLTNNPTITITPTPNTAILQSSLVMGEQNLQWILNGATSSPQNQEQIQQASKVEKVFF
TTAVPVASSPGSSVQQIGLSVPVIIIKQEEACQCQCACRDSAKERASSRRKGCSSPPPPE
PSPQAPDGPSLQLPAQTFSSAPVPGSSSSTLPSSCEQSRQAETPSDPQTETLSAMDVSEF
LSLQSLDTPSNLIPIEALLQGEEEMGLTSSFSK
Sequence length 753
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    PPARA activates gene expression
Activation of gene expression by SREBF (SREBP)
MTF1 activates gene expression
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Hypothyroidism Hypothyroidism N/A N/A GWAS
Mental retardation intellectual disability N/A N/A GenCC
Rheumatoid arthritis Rheumatoid arthritis N/A N/A GWAS
Systemic lupus erythematosus Systemic lupus erythematosus N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alcohol Related Disorders Associate 37505170
Breast Neoplasms Stimulate 20087061
Breast Neoplasms Associate 27847402, 36312586
Carcinoma Ductal Associate 27847402
Carcinoma Hepatocellular Associate 37124062
Cerebral Infarction Associate 37983626
Diabetes Mellitus Type 2 Associate 37904700
Disease Progression Stimulate 37095424
Esophageal Squamous Cell Carcinoma Associate 37866660
Fibrosarcoma Associate 20087061