Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	4519
Gene name	Mitochondrially encoded cytochrome b
Gene symbol	CYTB
Synonyms (NCBI Gene)	MTCYB
Chromosome	MT
Chromosome location	-

Show/Hide all (9)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049965	hsa-miR-29a-3p	CLASH	23622248
MIRT048433	hsa-miR-100-5p	CLASH	23622248
MIRT045822	hsa-miR-140-5p	CLASH	23622248
MIRT045100	hsa-miR-186-5p	CLASH	23622248
MIRT042521	hsa-miR-423-3p	CLASH	23622248
MIRT042521	hsa-miR-423-3p	CLASH	23622248
MIRT039477	hsa-miR-652-3p	CLASH	23622248
MIRT037484	hsa-miR-744-5p	CLASH	23622248
MIRT035968	hsa-miR-1301-3p	CLASH	23622248

Show/Hide all (39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEA
GO:0005739	Component	Mitochondrion	HDA	20833797
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IDA	28844695
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0006122	Process	Mitochondrial electron transport, ubiquinol to cytochrome c	IBA
GO:0006122	Process	Mitochondrial electron transport, ubiquinol to cytochrome c	NAS	6100559, 28844695
GO:0007584	Process	Response to nutrient	IEA
GO:0008121	Function	Quinol-cytochrome-c reductase activity	IBA
GO:0008121	Function	Quinol-cytochrome-c reductase activity	IEA
GO:0008121	Function	Quinol-cytochrome-c reductase activity	NAS	6100559
GO:0009055	Function	Electron transfer activity	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009636	Process	Response to toxic substance	IEA
GO:0009725	Process	Response to hormone	IEA
GO:0015990	Process	Electron transport coupled proton transport	IEA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0022904	Process	Respiratory electron transport chain	IEA
GO:0031100	Process	Animal organ regeneration	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0033590	Process	Response to cobalamin	IEA
GO:0033762	Process	Response to glucagon	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045275	Component	Respiratory chain complex III	IBA
GO:0045275	Component	Respiratory chain complex III	IEA
GO:0045275	Component	Respiratory chain complex III	NAS	6100559
GO:0045333	Process	Cellular respiration	NAS	28844695
GO:0045471	Process	Response to ethanol	IEA
GO:0046686	Process	Response to cadmium ion	IEA
GO:0046688	Process	Response to copper ion	IEA
GO:0046689	Process	Response to mercury ion	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051592	Process	Response to calcium ion	IEA
GO:0055093	Process	Response to hyperoxia	IEA
GO:1904421	Process	Response to D-galactosamine	IEA

MIM	HGNC	e!Ensembl
516020	7427	HGNC

P00156

Protein name

Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit)

Protein function

Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex) that is part of the mitochondrial respiratory chain. The b-c1 complex mediates electron transfer from ubiquinol to cytochrome c. Contributes to th

PDB

5XTE , 5XTH , 5XTI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00033	Cytochrome_B	18 → 204	Cytochrome b/b6/petB	Domain
PF00032	Cytochrom_B_C	258 → 359	Cytochrome b(C-terminal)/b6/petD	Domain

Sequence

MTPMRKTNPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFLAMHYSPDAS
TAFSSIAHITRDVNYGWIIRYLHANGASMFFICLFLHIGRGLYYGSFLYSETWNIGIILL
LATMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDLVQWIWGGYSVDSPTLTRFFT
FHFILPFIIAALATLHLLFLHETGSNNPLGITSHSDKITFHPYYTIKDALGLLLFLLSLM
TLTLFSPDLLGDPDNYTLANPLNTPPHIKPEWYFLFAYTILRSVPNKLGGVLALLLSILI
LAMIPILHMSKQQSMMFRPLSQSLYWLLAADLLILTWIGGQPVSYPFTIIGQVASVLYFT
TILILMPTISLIENKMLKWA

Sequence length

380

Interactions

View interactions

	KEGG		Reactome
	Oxidative phosphorylation Metabolic pathways Cardiac muscle contraction Thermogenesis Non-alcoholic fatty liver disease Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Prion disease Pathways of neurodegeneration - multiple diseases Chemical carcinogenesis - reactive oxygen species Diabetic cardiomyopathy		Respiratory electron transport

CYTB (mitochondrially encoded cytochrome b)