Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4515
Gene name	Mature T cell proliferation 1
Gene symbol	MTCP1
Synonyms (NCBI Gene)	P13MTCP1TCL1Cp8MTCP1
Chromosome	X
Chromosome location	Xq28
Summary	This gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5` exon spliced to two different sets of 3` exons that encode two dif

Show/Hide all (83)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029913	hsa-miR-26b-5p	Microarray	19088304
MIRT1162441	hsa-miR-127-3p	CLIP-seq
MIRT1162442	hsa-miR-1297	CLIP-seq
MIRT1162443	hsa-miR-142-5p	CLIP-seq
MIRT1162444	hsa-miR-18a	CLIP-seq
MIRT1162445	hsa-miR-18b	CLIP-seq
MIRT1162446	hsa-miR-199a-3p	CLIP-seq
MIRT1162447	hsa-miR-199b-3p	CLIP-seq
MIRT1162448	hsa-miR-2113	CLIP-seq
MIRT1162449	hsa-miR-26a	CLIP-seq
MIRT1162450	hsa-miR-26b	CLIP-seq
MIRT1162451	hsa-miR-302a	CLIP-seq
MIRT1162452	hsa-miR-302b	CLIP-seq
MIRT1162453	hsa-miR-302c	CLIP-seq
MIRT1162454	hsa-miR-302d	CLIP-seq
MIRT1162455	hsa-miR-302e	CLIP-seq
MIRT1162456	hsa-miR-3129-5p	CLIP-seq
MIRT1162457	hsa-miR-3137	CLIP-seq
MIRT1162458	hsa-miR-3140-3p	CLIP-seq
MIRT1162459	hsa-miR-3154	CLIP-seq
MIRT1162460	hsa-miR-3182	CLIP-seq
MIRT1162461	hsa-miR-338-5p	CLIP-seq
MIRT1162462	hsa-miR-340	CLIP-seq
MIRT1162463	hsa-miR-3681	CLIP-seq
MIRT1162464	hsa-miR-3685	CLIP-seq
MIRT1162465	hsa-miR-3686	CLIP-seq
MIRT1162466	hsa-miR-371-3p	CLIP-seq
MIRT1162467	hsa-miR-371b-3p	CLIP-seq
MIRT1162468	hsa-miR-372	CLIP-seq
MIRT1162469	hsa-miR-373	CLIP-seq
MIRT1162470	hsa-miR-384	CLIP-seq
MIRT1162471	hsa-miR-3942-5p	CLIP-seq
MIRT1162472	hsa-miR-410	CLIP-seq
MIRT1162473	hsa-miR-4251	CLIP-seq
MIRT1162474	hsa-miR-4303	CLIP-seq
MIRT1162475	hsa-miR-4329	CLIP-seq
MIRT1162476	hsa-miR-4418	CLIP-seq
MIRT1162477	hsa-miR-4465	CLIP-seq
MIRT1162478	hsa-miR-4659a-3p	CLIP-seq
MIRT1162479	hsa-miR-4659b-3p	CLIP-seq
MIRT1162480	hsa-miR-4666-3p	CLIP-seq
MIRT1162481	hsa-miR-4703-5p	CLIP-seq
MIRT1162482	hsa-miR-4735-3p	CLIP-seq
MIRT1162483	hsa-miR-4788	CLIP-seq
MIRT1162484	hsa-miR-498	CLIP-seq
MIRT1162485	hsa-miR-509-3-5p	CLIP-seq
MIRT1162486	hsa-miR-509-5p	CLIP-seq
MIRT1162487	hsa-miR-515-3p	CLIP-seq
MIRT1162488	hsa-miR-519a	CLIP-seq
MIRT1162489	hsa-miR-519b-3p	CLIP-seq
MIRT1162490	hsa-miR-519c-3p	CLIP-seq
MIRT1162491	hsa-miR-519e	CLIP-seq
MIRT1162492	hsa-miR-520a-3p	CLIP-seq
MIRT1162493	hsa-miR-520b	CLIP-seq
MIRT1162494	hsa-miR-520c-3p	CLIP-seq
MIRT1162495	hsa-miR-520d-3p	CLIP-seq
MIRT1162496	hsa-miR-520e	CLIP-seq
MIRT1162497	hsa-miR-520f	CLIP-seq
MIRT1162498	hsa-miR-545	CLIP-seq
MIRT1162499	hsa-miR-548a-5p	CLIP-seq
MIRT1162500	hsa-miR-548ab	CLIP-seq
MIRT1162501	hsa-miR-548ak	CLIP-seq
MIRT1162502	hsa-miR-548b-5p	CLIP-seq
MIRT1162503	hsa-miR-548c-5p	CLIP-seq
MIRT1162504	hsa-miR-548d-5p	CLIP-seq
MIRT1162505	hsa-miR-548h	CLIP-seq
MIRT1162506	hsa-miR-548i	CLIP-seq
MIRT1162507	hsa-miR-548j	CLIP-seq
MIRT1162508	hsa-miR-548k	CLIP-seq
MIRT1162509	hsa-miR-548l	CLIP-seq
MIRT1162510	hsa-miR-548w	CLIP-seq
MIRT1162511	hsa-miR-548y	CLIP-seq
MIRT1162512	hsa-miR-550a	CLIP-seq
MIRT1162513	hsa-miR-559	CLIP-seq
MIRT1162514	hsa-miR-628-5p	CLIP-seq
MIRT1162515	hsa-miR-653	CLIP-seq
MIRT2275717	hsa-miR-3614-5p	CLIP-seq
MIRT2275718	hsa-miR-3691-3p	CLIP-seq
MIRT2275719	hsa-miR-4768-5p	CLIP-seq
MIRT2275720	hsa-miR-4799-5p	CLIP-seq
MIRT2275721	hsa-miR-942	CLIP-seq
MIRT2438816	hsa-miR-3646	CLIP-seq
MIRT2438816	hsa-miR-3646	CLIP-seq

Show/Hide all (6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0019901	Function	Protein kinase binding	IPI	10983986
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0035556	Process	Intracellular signal transduction	IDA	10983986
GO:0043539	Function	Protein serine/threonine kinase activator activity	IBA
GO:0043539	Function	Protein serine/threonine kinase activator activity	IDA	10983986
GO:0043539	Function	Protein serine/threonine kinase activator activity	IEA

MIM	HGNC	e!Ensembl
300116	7423	ENSG00000214827

P56278

Protein name

Protein p13 MTCP-1 (p13MTCP1) (Mature T-cell proliferation-1 type B1) (MTCP-1 type B1)

Protein function

Enhances the phosphorylation and activation of AKT1 and AKT2.

PDB

1A1X , 1QTT , 1QTU

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01840	TCL1_MTCP1	1 → 105	TCL1/MTCP1 family	Family

Tissue specificity

TISSUE SPECIFICITY: Not found at a significant level in any tissue.

Sequence

MAGEDVGAPPDHLWVHQEGIYRDEYQRTWVAVVEEETSFLRARVQQIQVPLGDAARPSHL
LTSQLPLMWQLYPEERYMDNNSRLWQIQHHLMVRGVQELLLKLLPDD

Sequence length

107

Interactions

View interactions

	KEGG
	PI3K-Akt signaling pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Ataxia Telangiectasia	Associate	11752899	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Lymphocytic Chronic B Cell	Associate	11752899	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Lymphoma Adult T Cell	Associate	11839817	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Associate	39696784	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Prolymphocytic T Cell	Associate	11054065, 11839817, 17846228, 39696784, 9520380	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia T Cell	Associate	11752899	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma T Cell	Associate	9520380	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Myeloproliferative Diseases	Associate	35038703	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Inhibit	26521017	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Associate	35038703	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	39696784	★★★★★ ★☆☆☆☆ Found in Text Mining only

MTCP1 (mature T cell proliferation 1)