Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4514
Gene name Gene Name - the full gene name approved by the HGNC.	Mitochondrially encoded cytochrome c oxidase III
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	COX3
Synonyms (NCBI Gene) Gene synonyms aliases	COIII, MTCO3
Chromosome Chromosome number	MT
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	-

Show/Hide all(18)

miRTarBase ID	miRNA	Experiments	Reference
MIRT051976	hsa-let-7b-5p	CLASH	23622248
MIRT051976	hsa-let-7b-5p	CLASH	23622248
MIRT051976	hsa-let-7b-5p	CLASH	23622248
MIRT051745	hsa-let-7c-5p	CLASH	23622248
MIRT051535	hsa-let-7e-5p	CLASH	23622248
MIRT051535	hsa-let-7e-5p	CLASH	23622248
MIRT050111	hsa-miR-26a-5p	CLASH	23622248
MIRT048192	hsa-miR-196a-5p	CLASH	23622248
MIRT045024	hsa-miR-186-5p	CLASH	23622248
MIRT044848	hsa-miR-320a	CLASH	23622248
MIRT042659	hsa-miR-196b-5p	CLASH	23622248
MIRT042090	hsa-miR-484	CLASH	23622248
MIRT038946	hsa-miR-28-3p	CLASH	23622248
MIRT038405	hsa-miR-296-3p	CLASH	23622248
MIRT038405	hsa-miR-296-3p	CLASH	23622248
MIRT037543	hsa-miR-744-5p	CLASH	23622248
MIRT037543	hsa-miR-744-5p	CLASH	23622248
MIRT036178	hsa-miR-320c	CLASH	23622248

Show/Hide all(21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004129	Function	Cytochrome-c oxidase activity	IBA
GO:0004129	Function	Cytochrome-c oxidase activity	IEA
GO:0005515	Function	Protein binding	IPI	12059041
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0006123	Process	Mitochondrial electron transport, cytochrome c to oxygen	IBA
GO:0006123	Process	Mitochondrial electron transport, cytochrome c to oxygen	NAS	30030519
GO:0008535	Process	Respiratory chain complex IV assembly	IMP	8630495
GO:0009055	Function	Electron transfer activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0019646	Process	Aerobic electron transport chain	IEA
GO:0022904	Process	Respiratory electron transport chain	IEA
GO:0031966	Component	Mitochondrial membrane	IDA	30030519
GO:0045277	Component	Respiratory chain complex IV	IDA	1651240
GO:0045277	Component	Respiratory chain complex IV	IEA
GO:0045333	Process	Cellular respiration	NAS	30030519
GO:1902600	Process	Proton transmembrane transport	IEA

MIM	HGNC	e!Ensembl
516050	7422	HGNC

Protein

UniProt ID

P00414

Protein name

Cytochrome c oxidase subunit 3 (EC 7.1.1.9) (Cytochrome c oxidase polypeptide III)

Protein function

Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiqu

PDB

5Z62

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00510	COX3	6 → 261	Cytochrome c oxidase subunit III	Family

Sequence

MTHQSHAYHMVKPSPWPLTGALSALLMTSGLAMWFHFHSMTLLMLGLLTNTLTMYQWWRD
VTRESTYQGHHTPPVQKGLRYGMILFITSEVFFFAGFFWAFYHSSLAPTPQLGGHWPPTG
ITPLNPLEVPLLNTSVLLASGVSITWAHHSLMENNRNQMIQALLITILLGLYFTLLQASE
YFESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICFIRQLMFHFTSKHHFGFEAAAW
YWHFVDVVWLFLYVSIYWWGS

Sequence length

261

Interactions

View interactions

	KEGG		Reactome
	Oxidative phosphorylation Metabolic pathways Cardiac muscle contraction Thermogenesis Non-alcoholic fatty liver disease Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Prion disease Pathways of neurodegeneration - multiple diseases Chemical carcinogenesis - reactive oxygen species Diabetic cardiomyopathy		TP53 Regulates Metabolic Genes Respiratory electron transport

COX3 (mitochondrially encoded cytochrome c oxidase III)