Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	4513
Gene name	Mitochondrially encoded cytochrome c oxidase II
Gene symbol	COX2
Synonyms (NCBI Gene)	COIIMTCO2
Chromosome	MT
Chromosome location	-

Show/Hide all (49)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003964	hsa-miR-143-3p	Microarray	17875710
MIRT003965	hsa-miR-101-3p	Microarray	17875710
MIRT052383	hsa-let-7a-5p	CLASH	23622248
MIRT052290	hsa-let-7b-5p	CLASH	23622248
MIRT051845	hsa-let-7c-5p	CLASH	23622248
MIRT050864	hsa-miR-17-5p	CLASH	23622248
MIRT048680	hsa-miR-99a-5p	CLASH	23622248
MIRT048596	hsa-miR-100-5p	CLASH	23622248
MIRT044807	hsa-miR-320a	CLASH	23622248
MIRT039467	hsa-miR-652-3p	CLASH	23622248
MIRT039467	hsa-miR-652-3p	CLASH	23622248
MIRT038368	hsa-miR-296-3p	CLASH	23622248
MIRT037539	hsa-miR-744-5p	CLASH	23622248
MIRT035810	hsa-miR-1908-5p	CLASH	23622248
MIRT052894	hsa-miR-3934-5p	CLASH	23622248
MIRT053759	hsa-miR-143-5p	Luciferase reporter assayqRT-PCRWestern blot	24616567
MIRT003965	hsa-miR-101-3p	Luciferase reporter assayqRT-PCR	23608225
MIRT003965	hsa-miR-101-3p	Luciferase reporter assayqRT-PCR	23608225
MIRT438527	hsa-miR-146a-5p	Luciferase reporter assayqRT-PCR	25047043
MIRT438527	hsa-miR-146a-5p	Luciferase reporter assayqRT-PCR	25047043
MIRT438527	hsa-miR-146a-5p	Luciferase reporter assayqRT-PCR	25047043
MIRT437978	hsa-miR-137	FACSImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	25064845
MIRT437978	hsa-miR-137	FACSImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	25064845
MIRT438527	hsa-miR-146a-5p	Luciferase reporter assayqRT-PCR	25047043
MIRT438527	hsa-miR-146a-5p	Luciferase reporter assayqRT-PCR	25047043
MIRT438527	hsa-miR-146a-5p	Luciferase reporter assayqRT-PCR	25047043
MIRT437978	hsa-miR-137	FACSImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	25064845
MIRT437978	hsa-miR-137	FACSImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	25064845
MIRT731141	hsa-miR-26b-5p	qRT-PCRLuciferase reporter assayWestern blot	25483152
MIRT731141	hsa-miR-26b-5p	qRT-PCRLuciferase reporter assayWestern blot	25483152
MIRT438527	hsa-miR-146a-5p	Luciferase reporter assay	25767384
MIRT438527	hsa-miR-146a-5p	Luciferase reporter assay	25767384
MIRT438527	hsa-miR-146a-5p	Luciferase reporter assay	25767384
MIRT438527	hsa-miR-146a-5p	Luciferase reporter assay	25767384
MIRT438527	hsa-miR-146a-5p	Luciferase reporter assay	25767384
MIRT438527	hsa-miR-146a-5p	Luciferase reporter assayqRT-PCRWestern blot	25767384
MIRT438527	hsa-miR-146a-5p	Luciferase reporter assayqRT-PCRWestern blot	25767384
MIRT438527	hsa-miR-146a-5p	Luciferase reporter assayqRT-PCRWestern blot	25767384
MIRT438527	hsa-miR-146a-5p	Luciferase reporter assayqRT-PCRWestern blot	25767384
MIRT438527	hsa-miR-146a-5p	Luciferase reporter assayqRT-PCRWestern blot	25767384
MIRT438527	hsa-miR-146a-5p	Luciferase reporter assayqRT-PCRWestern blot	25767384
MIRT438527	hsa-miR-146a-5p	Luciferase reporter assayqRT-PCRWestern blot	25767384
MIRT438527	hsa-miR-146a-5p	Luciferase reporter assayqRT-PCRWestern blot	25767384
MIRT051845	hsa-let-7c-5p	qRT-PCR	31766503
MIRT733782	hsa-miR-542-3p	ELISAWestern blotting	33785768
MIRT733782	hsa-miR-542-3p	ELISAWestern blotting	33785768
MIRT734574	hsa-miR-105-3p	Immunohistochemistry (IHC)qRT-PCR	33123477
MIRT437978	hsa-miR-137	Luciferase reporter assayWestern blottingImmunofluorescenceqRT-PCR	32498294
MIRT438527	hsa-miR-146a-5p	Western blottingqRT-PCR	36409752

Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEA
GO:0004129	Function	Cytochrome-c oxidase activity	IBA
GO:0004129	Function	Cytochrome-c oxidase activity	IEA
GO:0004129	Function	Cytochrome-c oxidase activity	IMP	10486321
GO:0004129	Function	Cytochrome-c oxidase activity	NAS	2550900
GO:0005507	Function	Copper ion binding	IEA
GO:0005515	Function	Protein binding	IPI	23125284, 24403053, 24448823, 25464930, 25959673, 28330871, 29154948, 29355485, 29381136
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	16826196, 22802641
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IDA	19393246
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0006123	Process	Mitochondrial electron transport, cytochrome c to oxygen	ISS
GO:0006123	Process	Mitochondrial electron transport, cytochrome c to oxygen	NAS	2550900, 30030519
GO:0007595	Process	Lactation	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0022900	Process	Electron transport chain	IEA
GO:0031966	Component	Mitochondrial membrane	IBA
GO:0031966	Component	Mitochondrial membrane	IDA	30030519
GO:0042773	Process	ATP synthesis coupled electron transport	IBA
GO:0045277	Component	Respiratory chain complex IV	IBA
GO:0045277	Component	Respiratory chain complex IV	IDA	1651240
GO:0045277	Component	Respiratory chain complex IV	IEA
GO:0045333	Process	Cellular respiration	NAS	30030519
GO:0045471	Process	Response to ethanol	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:1902600	Process	Proton transmembrane transport	IEA

MIM	HGNC	e!Ensembl
516040	7421	HGNC

P00403

Protein name

Cytochrome c oxidase subunit 2 (EC 7.1.1.9) (Cytochrome c oxidase polypeptide II)

Protein function

Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiqu

PDB

3VRJ , 5Z62

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02790	COX2_TM	1 → 83	Cytochrome C oxidase subunit II, transmembrane domain	Family
PF00116	COX2	95 → 214	Cytochrome C oxidase subunit II, periplasmic domain	Domain

Sequence

MAHAAQVGLQDATSPIMEELITFHDHALMIIFLICFLVLYALFLTLTTKLTNTNISDAQE
METVWTILPAIILVLIALPSLRILYMTDEVNDPSLTIKSIGHQWYWTYEYTDYGGLIFNS
YMLPPLFLEPGDLRLLDVDNRVVLPIEAPIRMMITSQDVLHSWAVPTLGLKTDAIPGRLN
QTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVFTL

Sequence length

227

Interactions

View interactions

	KEGG		Reactome
	Oxidative phosphorylation Metabolic pathways Cardiac muscle contraction Thermogenesis Non-alcoholic fatty liver disease Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Prion disease Pathways of neurodegeneration - multiple diseases Chemical carcinogenesis - reactive oxygen species Diabetic cardiomyopathy		TP53 Regulates Metabolic Genes Respiratory electron transport

COX2 (mitochondrially encoded cytochrome c oxidase II)