Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4512
Gene name Gene Name - the full gene name approved by the HGNC.	Mitochondrially encoded cytochrome c oxidase I
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	COX1
Synonyms (NCBI Gene) Gene synonyms aliases	COI, MTCO1
Chromosome Chromosome number	MT
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	-

Show/Hide all(35)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052429	hsa-let-7a-5p	CLASH	23622248
MIRT051954	hsa-let-7b-5p	CLASH	23622248
MIRT051954	hsa-let-7b-5p	CLASH	23622248
MIRT051799	hsa-let-7c-5p	CLASH	23622248
MIRT051484	hsa-let-7e-5p	CLASH	23622248
MIRT051484	hsa-let-7e-5p	CLASH	23622248
MIRT051098	hsa-miR-16-5p	CLASH	23622248
MIRT050068	hsa-miR-26a-5p	CLASH	23622248
MIRT049491	hsa-miR-92a-3p	CLASH	23622248
MIRT046297	hsa-miR-23b-3p	CLASH	23622248
MIRT045588	hsa-miR-149-5p	CLASH	23622248
MIRT045588	hsa-miR-149-5p	CLASH	23622248
MIRT044969	hsa-miR-186-5p	CLASH	23622248
MIRT044969	hsa-miR-186-5p	CLASH	23622248
MIRT044552	hsa-miR-320a	CLASH	23622248
MIRT044069	hsa-miR-361-5p	CLASH	23622248
MIRT043967	hsa-miR-378a-5p	CLASH	23622248
MIRT043967	hsa-miR-378a-5p	CLASH	23622248
MIRT041609	hsa-miR-146b-5p	CLASH	23622248
MIRT041193	hsa-miR-193b-3p	CLASH	23622248
MIRT041193	hsa-miR-193b-3p	CLASH	23622248
MIRT040673	hsa-miR-92b-3p	CLASH	23622248
MIRT039899	hsa-miR-615-3p	CLASH	23622248
MIRT039016	hsa-miR-766-3p	CLASH	23622248
MIRT038518	hsa-miR-99b-3p	CLASH	23622248
MIRT038031	hsa-miR-423-5p	CLASH	23622248
MIRT037786	hsa-miR-550a-5p	CLASH	23622248
MIRT037747	hsa-miR-708-5p	CLASH	23622248
MIRT037444	hsa-miR-744-5p	CLASH	23622248
MIRT037444	hsa-miR-744-5p	CLASH	23622248
MIRT037444	hsa-miR-744-5p	CLASH	23622248
MIRT036706	hsa-miR-760	CLASH	23622248
MIRT035986	hsa-miR-1301-3p	CLASH	23622248
MIRT438459	hsa-miR-1-3p	Immunoprecipitaion, Luciferase reporter assay	25083871
MIRT438459	hsa-miR-1-3p	Immunoprecipitaion, Luciferase reporter assay	25083871

Transcription factors

Show/Hide all(4)

Transcription factor	Regulation	Reference
MLL4	Unknown	19570036
NFKB1	Unknown	19570036
NR3C1	Unknown	19570036
RELA	Unknown	19570036

Show/Hide all(28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEA
GO:0004129	Function	Cytochrome-c oxidase activity	IBA
GO:0004129	Function	Cytochrome-c oxidase activity	IEA
GO:0004129	Function	Cytochrome-c oxidase activity	IMP	12140182
GO:0005515	Function	Protein binding	IPI	12762840, 23260140, 26321642, 29154948, 33961781
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0006119	Process	Oxidative phosphorylation	IEA
GO:0006123	Process	Mitochondrial electron transport, cytochrome c to oxygen	NAS	30030519
GO:0006979	Process	Response to oxidative stress	IEA
GO:0009060	Process	Aerobic respiration	IBA
GO:0009060	Process	Aerobic respiration	IEA
GO:0016020	Component	Membrane	IEA
GO:0020037	Function	Heme binding	IEA
GO:0021549	Process	Cerebellum development	IEA
GO:0022904	Process	Respiratory electron transport chain	IBA
GO:0031966	Component	Mitochondrial membrane	IDA	30030519
GO:0045277	Component	Respiratory chain complex IV	IBA
GO:0045277	Component	Respiratory chain complex IV	IDA	1651240, 23168492
GO:0045277	Component	Respiratory chain complex IV	IEA
GO:0045277	Component	Respiratory chain complex IV	IMP	19393246
GO:0045333	Process	Cellular respiration	NAS	30030519
GO:0046688	Process	Response to copper ion	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051602	Process	Response to electrical stimulus	IEA
GO:1902600	Process	Proton transmembrane transport	IEA

MIM	HGNC	e!Ensembl
516030	7419	HGNC

Protein

UniProt ID

P00395

Protein name

Cytochrome c oxidase subunit 1 (EC 7.1.1.9) (Cytochrome c oxidase polypeptide I)

Protein function

Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiqu

PDB

5Z62

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00115	COX1	14 → 460	Cytochrome C and Quinol oxidase polypeptide I	Family

Sequence

MFADRWLFSTNHKDIGTLYLLFGAWAGVLGTALSLLIRAELGQPGNLLGNDHIYNVIVTA
HAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSLLLLLASAMVEA
GAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMTQYQ
TPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGH
PEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVD
TRAYFTSATMIIAIPTGVKVFSWLATLHGSNMKWSAAVLWALGFIFLFTVGGLTGIVLAN
SSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIG
VNLTFFPQHFLGLSGMPRRYSDYPDAYTTWNILSSVGSFISLTAVMLMIFMIWEAFASKR
KVLMVEEPSMNLEWLYGCPPPYHTFEEPVYMKS

Sequence length

513

Interactions

View interactions

	KEGG		Reactome
	Oxidative phosphorylation Metabolic pathways Cardiac muscle contraction Thermogenesis Non-alcoholic fatty liver disease Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Prion disease Pathways of neurodegeneration - multiple diseases Chemical carcinogenesis - reactive oxygen species Diabetic cardiomyopathy		TP53 Regulates Metabolic Genes Respiratory electron transport

COX1 (mitochondrially encoded cytochrome c oxidase I)