Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	4508
Gene name	Mitochondrially encoded ATP synthase 6
Gene symbol	ATP6
Synonyms (NCBI Gene)	ATPase6MTATP6
Chromosome	MT
Chromosome location	-

Show/Hide all (29)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052432	hsa-let-7a-5p	CLASH	23622248
MIRT052042	hsa-let-7b-5p	CLASH	23622248
MIRT052042	hsa-let-7b-5p	CLASH	23622248
MIRT052042	hsa-let-7b-5p	CLASH	23622248
MIRT052042	hsa-let-7b-5p	CLASH	23622248
MIRT051758	hsa-let-7c-5p	CLASH	23622248
MIRT051758	hsa-let-7c-5p	CLASH	23622248
MIRT051758	hsa-let-7c-5p	CLASH	23622248
MIRT051625	hsa-let-7e-5p	CLASH	23622248
MIRT050816	hsa-miR-17-5p	CLASH	23622248
MIRT050816	hsa-miR-17-5p	CLASH	23622248
MIRT050816	hsa-miR-17-5p	CLASH	23622248
MIRT050503	hsa-miR-20a-5p	CLASH	23622248
MIRT050503	hsa-miR-20a-5p	CLASH	23622248
MIRT048900	hsa-miR-93-5p	CLASH	23622248
MIRT048206	hsa-miR-196a-5p	CLASH	23622248
MIRT047298	hsa-miR-181b-5p	CLASH	23622248
MIRT044973	hsa-miR-186-5p	CLASH	23622248
MIRT044383	hsa-miR-200c-3p	CLASH	23622248
MIRT042670	hsa-miR-196b-5p	CLASH	23622248
MIRT041175	hsa-miR-181d-5p	CLASH	23622248
MIRT039615	hsa-miR-615-3p	CLASH	23622248
MIRT038398	hsa-miR-296-3p	CLASH	23622248
MIRT038045	hsa-miR-423-5p	CLASH	23622248
MIRT038045	hsa-miR-423-5p	CLASH	23622248
MIRT037434	hsa-miR-744-5p	CLASH	23622248
MIRT037434	hsa-miR-744-5p	CLASH	23622248
MIRT037434	hsa-miR-744-5p	CLASH	23622248
MIRT035809	hsa-miR-1908-5p	CLASH	23622248

Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	30318146
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IC	12110673
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	NAS	26297831
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0006754	Process	ATP biosynthetic process	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0015078	Function	Proton transmembrane transporter activity	IEA
GO:0015252	Function	Proton channel activity	IDA	37244256
GO:0015986	Process	Proton motive force-driven ATP synthesis	IBA
GO:0015986	Process	Proton motive force-driven ATP synthesis	IDA	37244256
GO:0015986	Process	Proton motive force-driven ATP synthesis	IEA
GO:0015986	Process	Proton motive force-driven ATP synthesis	NAS	26297831
GO:0016020	Component	Membrane	IEA
GO:0042776	Process	Proton motive force-driven mitochondrial ATP synthesis	IDA	12110673
GO:0045259	Component	Proton-transporting ATP synthase complex	IBA
GO:0045259	Component	Proton-transporting ATP synthase complex	IDA	12110673, 37244256
GO:0045259	Component	Proton-transporting ATP synthase complex	IEA
GO:0045259	Component	Proton-transporting ATP synthase complex	NAS	26297831
GO:0046933	Function	Proton-transporting ATP synthase activity, rotational mechanism	IBA
GO:0046933	Function	Proton-transporting ATP synthase activity, rotational mechanism	IDA	12110673
GO:0055093	Process	Response to hyperoxia	IEA
GO:1902600	Process	Proton transmembrane transport	IDA	37244256
GO:1902600	Process	Proton transmembrane transport	IEA

MIM	HGNC	e!Ensembl
516060	7414	HGNC

P00846

Protein name

ATP synthase F(0) complex subunit a (F-ATPase protein 6) (Proton-conducting channel, ATP synthase F(0) complex subunit a)

Protein function

Subunit a, of the mitochondrial membrane ATP synthase complex (F(1)F(0) ATP synthase or Complex V) that produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the resp

PDB

8H9F , 8H9J , 8H9M , 8H9Q , 8H9S , 8H9T , 8H9U , 8H9V , 8KHF , 8KI3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00119	ATP-synt_A	14 → 223	ATP synthase A chain	Domain

Sequence

MNENLFASFIAPTILGLPAAVLIILFPPLLIPTSKYLINNRLITTQQWLIKLTSKQMMTM
HNTKGRTWSLMLVSLIIFIATTNLLGLLPHSFTPTTQLSMNLAMAIPLWAGTVIMGFRSK
IKNALAHFLPQGTPTPLIPMLVIIETISLLIQPMALAVRLTANITAGHLLMHLIGSATLA
MSTINLPSTLIIFTILILLTILEIAVALIQAYVFTLLVSLYLHDNT

Sequence length

226

Interactions

View interactions

	KEGG		Reactome
	Oxidative phosphorylation Metabolic pathways Thermogenesis Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Prion disease Pathways of neurodegeneration - multiple diseases Chemical carcinogenesis - reactive oxygen species Diabetic cardiomyopathy		Formation of ATP by chemiosmotic coupling Cristae formation

ATP6 (mitochondrially encoded ATP synthase 6)