Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	4502
Gene name	Metallothionein 2A
Gene symbol	MT2A
Synonyms (NCBI Gene)	MT-2MT-IIMT2
Chromosome	16
Chromosome location	16q13
Summary	This gene is a member of the metallothionein family of genes. Proteins encoded by this gene family are low in molecular weight, are cysteine-rich, lack aromatic residues, and bind divalent heavy metal ions, altering the intracellular concentration of heav

133

Show/Hide all (133)

miRTarBase ID	miRNA	Experiments	Reference
MIRT053519	hsa-miR-23a-3p	ImmunofluorescenceImmunohistochemistryIn situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	23553990
MIRT486125	hsa-miR-548c-3p	PAR-CLIP	23592263
MIRT486124	hsa-miR-4668-3p	PAR-CLIP	23592263
MIRT486123	hsa-miR-553	PAR-CLIP	23592263
MIRT284325	hsa-miR-296-3p	PAR-CLIP	23592263
MIRT284328	hsa-miR-6823-5p	PAR-CLIP	23592263
MIRT284327	hsa-miR-3613-5p	PAR-CLIP	23592263
MIRT284323	hsa-let-7c-3p	PAR-CLIP	23592263
MIRT284322	hsa-let-7a-2-3p	PAR-CLIP	23592263
MIRT284324	hsa-let-7g-3p	PAR-CLIP	23592263
MIRT284326	hsa-miR-493-5p	PAR-CLIP	23592263
MIRT486125	hsa-miR-548c-3p	PAR-CLIP	23592263
MIRT486124	hsa-miR-4668-3p	PAR-CLIP	23592263
MIRT486123	hsa-miR-553	PAR-CLIP	23592263
MIRT284325	hsa-miR-296-3p	PAR-CLIP	23592263
MIRT284328	hsa-miR-6823-5p	PAR-CLIP	23592263
MIRT284327	hsa-miR-3613-5p	PAR-CLIP	23592263
MIRT284323	hsa-let-7c-3p	PAR-CLIP	23592263
MIRT284322	hsa-let-7a-2-3p	PAR-CLIP	23592263
MIRT284324	hsa-let-7g-3p	PAR-CLIP	23592263
MIRT284326	hsa-miR-493-5p	PAR-CLIP	23592263
MIRT1162144	hsa-miR-23a	CLIP-seq
MIRT1162145	hsa-miR-23b	CLIP-seq
MIRT1162146	hsa-miR-23c	CLIP-seq
MIRT1162147	hsa-miR-3190	CLIP-seq
MIRT1162148	hsa-miR-3192	CLIP-seq
MIRT1162149	hsa-miR-320a	CLIP-seq
MIRT1162150	hsa-miR-320b	CLIP-seq
MIRT1162151	hsa-miR-320c	CLIP-seq
MIRT1162152	hsa-miR-320d	CLIP-seq
MIRT1162153	hsa-miR-330-3p	CLIP-seq
MIRT1162154	hsa-miR-376a	CLIP-seq
MIRT1162155	hsa-miR-376b	CLIP-seq
MIRT1162156	hsa-miR-4300	CLIP-seq
MIRT1162157	hsa-miR-4314	CLIP-seq
MIRT1162158	hsa-miR-4429	CLIP-seq
MIRT1162159	hsa-miR-4464	CLIP-seq
MIRT1162160	hsa-miR-4646-5p	CLIP-seq
MIRT1162161	hsa-miR-4748	CLIP-seq
MIRT1162162	hsa-miR-4752	CLIP-seq
MIRT1162163	hsa-miR-4795-3p	CLIP-seq
MIRT1162164	hsa-miR-548p	CLIP-seq
MIRT1162165	hsa-miR-920	CLIP-seq
MIRT1162144	hsa-miR-23a	CLIP-seq
MIRT1162145	hsa-miR-23b	CLIP-seq
MIRT1162146	hsa-miR-23c	CLIP-seq
MIRT1162147	hsa-miR-3190	CLIP-seq
MIRT1162149	hsa-miR-320a	CLIP-seq
MIRT1162150	hsa-miR-320b	CLIP-seq
MIRT1162151	hsa-miR-320c	CLIP-seq
MIRT1162152	hsa-miR-320d	CLIP-seq
MIRT1162153	hsa-miR-330-3p	CLIP-seq
MIRT1162154	hsa-miR-376a	CLIP-seq
MIRT1162155	hsa-miR-376b	CLIP-seq
MIRT1162158	hsa-miR-4429	CLIP-seq
MIRT1162159	hsa-miR-4464	CLIP-seq
MIRT1162161	hsa-miR-4748	CLIP-seq
MIRT1162162	hsa-miR-4752	CLIP-seq
MIRT1162163	hsa-miR-4795-3p	CLIP-seq
MIRT1162164	hsa-miR-548p	CLIP-seq
MIRT1162144	hsa-miR-23a	CLIP-seq
MIRT1162145	hsa-miR-23b	CLIP-seq
MIRT1162146	hsa-miR-23c	CLIP-seq
MIRT1162147	hsa-miR-3190	CLIP-seq
MIRT1162154	hsa-miR-376a	CLIP-seq
MIRT1162155	hsa-miR-376b	CLIP-seq
MIRT1162159	hsa-miR-4464	CLIP-seq
MIRT1162161	hsa-miR-4748	CLIP-seq
MIRT1162162	hsa-miR-4752	CLIP-seq
MIRT1162163	hsa-miR-4795-3p	CLIP-seq
MIRT1162164	hsa-miR-548p	CLIP-seq
MIRT1162144	hsa-miR-23a	CLIP-seq
MIRT1162145	hsa-miR-23b	CLIP-seq
MIRT1162146	hsa-miR-23c	CLIP-seq
MIRT1162147	hsa-miR-3190	CLIP-seq
MIRT1162148	hsa-miR-3192	CLIP-seq
MIRT1162149	hsa-miR-320a	CLIP-seq
MIRT1162150	hsa-miR-320b	CLIP-seq
MIRT1162151	hsa-miR-320c	CLIP-seq
MIRT1162152	hsa-miR-320d	CLIP-seq
MIRT1162154	hsa-miR-376a	CLIP-seq
MIRT1162155	hsa-miR-376b	CLIP-seq
MIRT1162156	hsa-miR-4300	CLIP-seq
MIRT1162157	hsa-miR-4314	CLIP-seq
MIRT1162158	hsa-miR-4429	CLIP-seq
MIRT1162159	hsa-miR-4464	CLIP-seq
MIRT2391126	hsa-miR-4508	CLIP-seq
MIRT1162160	hsa-miR-4646-5p	CLIP-seq
MIRT2391127	hsa-miR-4675	CLIP-seq
MIRT2391128	hsa-miR-4741	CLIP-seq
MIRT1162161	hsa-miR-4748	CLIP-seq
MIRT1162162	hsa-miR-4752	CLIP-seq
MIRT2391129	hsa-miR-4781-5p	CLIP-seq
MIRT1162163	hsa-miR-4795-3p	CLIP-seq
MIRT1162164	hsa-miR-548p	CLIP-seq
MIRT2391130	hsa-miR-744	CLIP-seq
MIRT1162165	hsa-miR-920	CLIP-seq
MIRT1162147	hsa-miR-3190	CLIP-seq
MIRT1162159	hsa-miR-4464	CLIP-seq
MIRT1162161	hsa-miR-4748	CLIP-seq
MIRT1162162	hsa-miR-4752	CLIP-seq
MIRT1162147	hsa-miR-3190	CLIP-seq
MIRT1162159	hsa-miR-4464	CLIP-seq
MIRT1162161	hsa-miR-4748	CLIP-seq
MIRT1162162	hsa-miR-4752	CLIP-seq
MIRT1162147	hsa-miR-3190	CLIP-seq
MIRT1162148	hsa-miR-3192	CLIP-seq
MIRT1162156	hsa-miR-4300	CLIP-seq
MIRT1162157	hsa-miR-4314	CLIP-seq
MIRT1162159	hsa-miR-4464	CLIP-seq
MIRT2391126	hsa-miR-4508	CLIP-seq
MIRT1162160	hsa-miR-4646-5p	CLIP-seq
MIRT2391127	hsa-miR-4675	CLIP-seq
MIRT2391128	hsa-miR-4741	CLIP-seq
MIRT1162161	hsa-miR-4748	CLIP-seq
MIRT1162162	hsa-miR-4752	CLIP-seq
MIRT2391129	hsa-miR-4781-5p	CLIP-seq
MIRT2391130	hsa-miR-744	CLIP-seq
MIRT1162165	hsa-miR-920	CLIP-seq
MIRT1162147	hsa-miR-3190	CLIP-seq
MIRT1162148	hsa-miR-3192	CLIP-seq
MIRT1162156	hsa-miR-4300	CLIP-seq
MIRT1162157	hsa-miR-4314	CLIP-seq
MIRT1162159	hsa-miR-4464	CLIP-seq
MIRT2391126	hsa-miR-4508	CLIP-seq
MIRT1162160	hsa-miR-4646-5p	CLIP-seq
MIRT2391127	hsa-miR-4675	CLIP-seq
MIRT2391128	hsa-miR-4741	CLIP-seq
MIRT1162161	hsa-miR-4748	CLIP-seq
MIRT1162162	hsa-miR-4752	CLIP-seq
MIRT2391129	hsa-miR-4781-5p	CLIP-seq
MIRT2391130	hsa-miR-744	CLIP-seq
MIRT1162165	hsa-miR-920	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
AHR	Unknown	23994556

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	12646258, 12970870, 14550308, 15541360, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	TAS
GO:0006878	Process	Intracellular copper ion homeostasis	TAS	6719135
GO:0006882	Process	Intracellular zinc ion homeostasis	IBA
GO:0008270	Function	Zinc ion binding	ISS
GO:0010273	Process	Detoxification of copper ion	IBA
GO:0036016	Process	Cellular response to interleukin-3	IEP	11168427
GO:0036018	Process	Cellular response to erythropoietin	IEP	11168427
GO:0045926	Process	Negative regulation of growth	ISS
GO:0046872	Function	Metal ion binding	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0071276	Process	Cellular response to cadmium ion	IBA
GO:0071280	Process	Cellular response to copper ion	IBA
GO:0071294	Process	Cellular response to zinc ion	IBA
GO:0071294	Process	Cellular response to zinc ion	IEP	11168427

MIM	HGNC	e!Ensembl
156360	7406	ENSG00000125148

P02795

Protein name

Metallothionein-2 (MT-2) (Metallothionein-2A) (Metallothionein-II) (MT-II)

Protein function

Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.

PDB

1MHU , 2MHU

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00131	Metallothio	1 → 61	Metallothionein	Domain

Sequence

MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCC
A

Sequence length

Interactions

View interactions

	KEGG		Reactome
	Mineral absorption		Metallothioneins bind metals Interferon gamma signaling

MT2A (metallothionein 2A)