Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4502
Gene name Gene Name - the full gene name approved by the HGNC.	Metallothionein 2A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MT2A
Synonyms (NCBI Gene) Gene synonyms aliases	MT-2, MT-II, MT2
Chromosome Chromosome number	16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	16q13
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is a member of the metallothionein family of genes. Proteins encoded by this gene family are low in molecular weight, are cysteine-rich, lack aromatic residues, and bind divalent heavy metal ions, altering the intracellular concentration of heav

Show/Hide all(133)

miRTarBase ID	miRNA	Experiments	Reference
MIRT053519	hsa-miR-23a-3p	Immunofluorescence, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	23553990
MIRT486125	hsa-miR-548c-3p	PAR-CLIP	23592263
MIRT486124	hsa-miR-4668-3p	PAR-CLIP	23592263
MIRT486123	hsa-miR-553	PAR-CLIP	23592263
MIRT284325	hsa-miR-296-3p	PAR-CLIP	23592263
MIRT284328	hsa-miR-6823-5p	PAR-CLIP	23592263
MIRT284327	hsa-miR-3613-5p	PAR-CLIP	23592263
MIRT284323	hsa-let-7c-3p	PAR-CLIP	23592263
MIRT284322	hsa-let-7a-2-3p	PAR-CLIP	23592263
MIRT284324	hsa-let-7g-3p	PAR-CLIP	23592263
MIRT284326	hsa-miR-493-5p	PAR-CLIP	23592263
MIRT486125	hsa-miR-548c-3p	PAR-CLIP	23592263
MIRT486124	hsa-miR-4668-3p	PAR-CLIP	23592263
MIRT486123	hsa-miR-553	PAR-CLIP	23592263
MIRT284325	hsa-miR-296-3p	PAR-CLIP	23592263
MIRT284328	hsa-miR-6823-5p	PAR-CLIP	23592263
MIRT284327	hsa-miR-3613-5p	PAR-CLIP	23592263
MIRT284323	hsa-let-7c-3p	PAR-CLIP	23592263
MIRT284322	hsa-let-7a-2-3p	PAR-CLIP	23592263
MIRT284324	hsa-let-7g-3p	PAR-CLIP	23592263
MIRT284326	hsa-miR-493-5p	PAR-CLIP	23592263
MIRT1162144	hsa-miR-23a	CLIP-seq
MIRT1162145	hsa-miR-23b	CLIP-seq
MIRT1162146	hsa-miR-23c	CLIP-seq
MIRT1162147	hsa-miR-3190	CLIP-seq
MIRT1162148	hsa-miR-3192	CLIP-seq
MIRT1162149	hsa-miR-320a	CLIP-seq
MIRT1162150	hsa-miR-320b	CLIP-seq
MIRT1162151	hsa-miR-320c	CLIP-seq
MIRT1162152	hsa-miR-320d	CLIP-seq
MIRT1162153	hsa-miR-330-3p	CLIP-seq
MIRT1162154	hsa-miR-376a	CLIP-seq
MIRT1162155	hsa-miR-376b	CLIP-seq
MIRT1162156	hsa-miR-4300	CLIP-seq
MIRT1162157	hsa-miR-4314	CLIP-seq
MIRT1162158	hsa-miR-4429	CLIP-seq
MIRT1162159	hsa-miR-4464	CLIP-seq
MIRT1162160	hsa-miR-4646-5p	CLIP-seq
MIRT1162161	hsa-miR-4748	CLIP-seq
MIRT1162162	hsa-miR-4752	CLIP-seq
MIRT1162163	hsa-miR-4795-3p	CLIP-seq
MIRT1162164	hsa-miR-548p	CLIP-seq
MIRT1162165	hsa-miR-920	CLIP-seq
MIRT1162144	hsa-miR-23a	CLIP-seq
MIRT1162145	hsa-miR-23b	CLIP-seq
MIRT1162146	hsa-miR-23c	CLIP-seq
MIRT1162147	hsa-miR-3190	CLIP-seq
MIRT1162149	hsa-miR-320a	CLIP-seq
MIRT1162150	hsa-miR-320b	CLIP-seq
MIRT1162151	hsa-miR-320c	CLIP-seq
MIRT1162152	hsa-miR-320d	CLIP-seq
MIRT1162153	hsa-miR-330-3p	CLIP-seq
MIRT1162154	hsa-miR-376a	CLIP-seq
MIRT1162155	hsa-miR-376b	CLIP-seq
MIRT1162158	hsa-miR-4429	CLIP-seq
MIRT1162159	hsa-miR-4464	CLIP-seq
MIRT1162161	hsa-miR-4748	CLIP-seq
MIRT1162162	hsa-miR-4752	CLIP-seq
MIRT1162163	hsa-miR-4795-3p	CLIP-seq
MIRT1162164	hsa-miR-548p	CLIP-seq
MIRT1162144	hsa-miR-23a	CLIP-seq
MIRT1162145	hsa-miR-23b	CLIP-seq
MIRT1162146	hsa-miR-23c	CLIP-seq
MIRT1162147	hsa-miR-3190	CLIP-seq
MIRT1162154	hsa-miR-376a	CLIP-seq
MIRT1162155	hsa-miR-376b	CLIP-seq
MIRT1162159	hsa-miR-4464	CLIP-seq
MIRT1162161	hsa-miR-4748	CLIP-seq
MIRT1162162	hsa-miR-4752	CLIP-seq
MIRT1162163	hsa-miR-4795-3p	CLIP-seq
MIRT1162164	hsa-miR-548p	CLIP-seq
MIRT1162144	hsa-miR-23a	CLIP-seq
MIRT1162145	hsa-miR-23b	CLIP-seq
MIRT1162146	hsa-miR-23c	CLIP-seq
MIRT1162147	hsa-miR-3190	CLIP-seq
MIRT1162148	hsa-miR-3192	CLIP-seq
MIRT1162149	hsa-miR-320a	CLIP-seq
MIRT1162150	hsa-miR-320b	CLIP-seq
MIRT1162151	hsa-miR-320c	CLIP-seq
MIRT1162152	hsa-miR-320d	CLIP-seq
MIRT1162154	hsa-miR-376a	CLIP-seq
MIRT1162155	hsa-miR-376b	CLIP-seq
MIRT1162156	hsa-miR-4300	CLIP-seq
MIRT1162157	hsa-miR-4314	CLIP-seq
MIRT1162158	hsa-miR-4429	CLIP-seq
MIRT1162159	hsa-miR-4464	CLIP-seq
MIRT2391126	hsa-miR-4508	CLIP-seq
MIRT1162160	hsa-miR-4646-5p	CLIP-seq
MIRT2391127	hsa-miR-4675	CLIP-seq
MIRT2391128	hsa-miR-4741	CLIP-seq
MIRT1162161	hsa-miR-4748	CLIP-seq
MIRT1162162	hsa-miR-4752	CLIP-seq
MIRT2391129	hsa-miR-4781-5p	CLIP-seq
MIRT1162163	hsa-miR-4795-3p	CLIP-seq
MIRT1162164	hsa-miR-548p	CLIP-seq
MIRT2391130	hsa-miR-744	CLIP-seq
MIRT1162165	hsa-miR-920	CLIP-seq
MIRT1162147	hsa-miR-3190	CLIP-seq
MIRT1162159	hsa-miR-4464	CLIP-seq
MIRT1162161	hsa-miR-4748	CLIP-seq
MIRT1162162	hsa-miR-4752	CLIP-seq
MIRT1162147	hsa-miR-3190	CLIP-seq
MIRT1162159	hsa-miR-4464	CLIP-seq
MIRT1162161	hsa-miR-4748	CLIP-seq
MIRT1162162	hsa-miR-4752	CLIP-seq
MIRT1162147	hsa-miR-3190	CLIP-seq
MIRT1162148	hsa-miR-3192	CLIP-seq
MIRT1162156	hsa-miR-4300	CLIP-seq
MIRT1162157	hsa-miR-4314	CLIP-seq
MIRT1162159	hsa-miR-4464	CLIP-seq
MIRT2391126	hsa-miR-4508	CLIP-seq
MIRT1162160	hsa-miR-4646-5p	CLIP-seq
MIRT2391127	hsa-miR-4675	CLIP-seq
MIRT2391128	hsa-miR-4741	CLIP-seq
MIRT1162161	hsa-miR-4748	CLIP-seq
MIRT1162162	hsa-miR-4752	CLIP-seq
MIRT2391129	hsa-miR-4781-5p	CLIP-seq
MIRT2391130	hsa-miR-744	CLIP-seq
MIRT1162165	hsa-miR-920	CLIP-seq
MIRT1162147	hsa-miR-3190	CLIP-seq
MIRT1162148	hsa-miR-3192	CLIP-seq
MIRT1162156	hsa-miR-4300	CLIP-seq
MIRT1162157	hsa-miR-4314	CLIP-seq
MIRT1162159	hsa-miR-4464	CLIP-seq
MIRT2391126	hsa-miR-4508	CLIP-seq
MIRT1162160	hsa-miR-4646-5p	CLIP-seq
MIRT2391127	hsa-miR-4675	CLIP-seq
MIRT2391128	hsa-miR-4741	CLIP-seq
MIRT1162161	hsa-miR-4748	CLIP-seq
MIRT1162162	hsa-miR-4752	CLIP-seq
MIRT2391129	hsa-miR-4781-5p	CLIP-seq
MIRT2391130	hsa-miR-744	CLIP-seq
MIRT1162165	hsa-miR-920	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
AHR	Unknown	23994556

Show/Hide all(19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	12646258, 12970870, 14550308, 15541360, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	TAS
GO:0006878	Process	Intracellular copper ion homeostasis	TAS	6719135
GO:0006882	Process	Intracellular zinc ion homeostasis	IBA
GO:0008270	Function	Zinc ion binding	ISS
GO:0010273	Process	Detoxification of copper ion	IBA
GO:0036016	Process	Cellular response to interleukin-3	IEP	11168427
GO:0036018	Process	Cellular response to erythropoietin	IEP	11168427
GO:0045926	Process	Negative regulation of growth	ISS
GO:0046872	Function	Metal ion binding	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0071276	Process	Cellular response to cadmium ion	IBA
GO:0071280	Process	Cellular response to copper ion	IBA
GO:0071294	Process	Cellular response to zinc ion	IBA
GO:0071294	Process	Cellular response to zinc ion	IEP	11168427

MIM	HGNC	e!Ensembl
156360	7406	ENSG00000125148

Protein

UniProt ID

P02795

Protein name

Metallothionein-2 (MT-2) (Metallothionein-2A) (Metallothionein-II) (MT-II)

Protein function

Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.

PDB

1MHU , 2MHU

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00131	Metallothio	1 → 61	Metallothionein	Domain

Sequence

MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCC
A

Sequence length

Interactions

View interactions

	KEGG		Reactome
	Mineral absorption		Metallothioneins bind metals Interferon gamma signaling

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Eosinophilia	Eosinophilic esophagitis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (106)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acquired Immunodeficiency Syndrome	Associate	6333258, 7908672
Adenocarcinoma	Associate	31721970
Adenocarcinoma of Lung	Associate	33839701
Alzheimer Disease	Associate	17213040, 30124448
Amblyopia	Associate	10803406
Arthritis Rheumatoid	Associate	39321281
Astrocytoma	Stimulate	30932010
Autism Spectrum Disorder	Associate	36077244
Bloom Syndrome	Associate	28228606
Bone Diseases	Associate	26036762
Breast Neoplasms	Associate	14578200, 20652934, 21187089, 23053628, 28228606, 35650297
Carcinogenesis	Associate	23870553
Carcinoma Basal Cell	Associate	23042264
Carcinoma Hepatocellular	Associate	35650297
Carcinoma Mucoepidermoid	Associate	31936364
Carcinoma Renal Cell	Associate	24763884
Cardiovascular Diseases	Associate	30466987
Carotid Stenosis	Associate	17622311
Cataract	Associate	14551530
Cataract congenital dominant non nuclear	Associate	31721970
Chronobiology Disorders	Associate	31019305
Cognitive Dysfunction	Associate	30466987
Colorectal Neoplasms	Associate	28061540, 28604612
Compassion Fatigue	Associate	23028585
Coronary Artery Disease	Associate	25555862
Coronary Disease	Associate	25555862
Crohn Disease	Associate	19603079
Death	Associate	7908672
Depressive Disorder	Stimulate	31321953
Diabetes Mellitus	Associate	17622311, 27122239
Diabetes Mellitus Type 2	Associate	18349110
Down Syndrome	Associate	31540037, 35741790
Dyslipidemias	Associate	30466987
Endometriosis	Associate	36232817
Epilepsy Familial Mesial Temporal Lobe	Associate	23028585
Epilepsy Temporal Lobe	Associate	23028585, 31321953
Esophageal Neoplasms	Associate	37027423
Esophageal Squamous Cell Carcinoma	Associate	36466860
Gastritis	Associate	36060520
Gastrointestinal Stromal Tumors	Associate	21235001, 23986211
Glioblastoma	Stimulate	30932010
Gliosis	Associate	23028585, 31321953
Glycogen Storage Disease Type IV	Stimulate	30932010
Growth Disorders	Associate	26036762
Helicobacter Infections	Associate	36060520
HTLV I Infections	Associate	7908672
Hypertension	Associate	30466987
Hypertensive Retinopathy	Associate	30466987
Ichthyosis prematurity syndrome	Associate	29693144
Incontinentia Pigmenti	Associate	26036762
Inflammation	Associate	17622311, 30466987, 31007603
Inflammatory Bowel Diseases	Associate	27216938
Intellectual Disability	Associate	30466987
Intervertebral Disc Degeneration	Associate	35409356
Intestinal Diseases	Inhibit	23870553
Kashin Beck Disease	Associate	34045450
Kidney Diseases	Associate	34437439
Leiomyoma	Associate	36981043
Leukemia Myeloid Acute	Associate	34220318
Liver Cirrhosis	Associate	35650297
Lung Neoplasms	Associate	23947958, 35650297
Lymphoma B Cell	Associate	2464283
Lymphoma Large B Cell Diffuse	Associate	16868254
Lymphoma T Cell	Associate	2464283
Mental Disorders	Associate	25770211
Mental Disorders	Stimulate	31321953
Mesothelioma Malignant	Associate	33122816
Metabolic Diseases	Associate	30466987
Mood Disorders	Associate	31019305
Mouth Neoplasms	Associate	33340085
Multiple Myeloma	Associate	15725085
Myeloproliferative Disorder Chronic with Eosinophilia	Associate	2464283
Nasopharyngeal Carcinoma	Associate	16549050
Neoplasm Metastasis	Inhibit	27736994
Neoplasms	Inhibit	23870553, 36077244
Neoplasms	Associate	23986211, 24157868, 26036762, 27736994, 28061540, 28228606, 28604612, 30466987, 31721970, 32809904, 34220318, 36690679, 37406106
Neoplasms	Stimulate	26133168, 26168959
Nerve Degeneration	Inhibit	23028585
Nervous System Diseases	Associate	18349110
Neuralgia	Stimulate	38521157
Neuroinflammatory Diseases	Associate	25889039
Neurologic Manifestations	Associate	30466987
Neurotoxicity Syndromes	Associate	32340109
Osteosarcoma	Associate	24157868
Pancreatic Neoplasms	Associate	26579577
Pancreatitis	Associate	34072023
Papilloma	Associate	26036762
Papilloma Inverted	Associate	26036762, 38165205
Papillomavirus Infections	Associate	26666815
Periodontal Diseases	Associate	31540037
Peripheral Nervous System Diseases	Associate	32340109
Prostatic Hyperplasia	Inhibit	18208603
Prostatic Neoplasms	Associate	18208603, 35650297
Prostatitis	Associate	18208603
Pseudolymphoma	Associate	2464283
Psychotic Disorders	Associate	18992145
Pulmonary Disease Chronic Obstructive	Associate	9926163
Renal Insufficiency Chronic	Associate	27122239
Renal Insufficiency Chronic	Inhibit	34437439
Seizures	Associate	23028585
Sleep Initiation and Maintenance Disorders	Associate	31019305
Squamous Cell Carcinoma of Head and Neck	Associate	26666815, 33340085
Status Epilepticus	Inhibit	23028585
Stomach Neoplasms	Associate	21235001, 31380415, 35650297, 36060520
Stomach Neoplasms	Inhibit	23870553
Thyroid Carcinoma Anaplastic	Associate	17485079

MT2A (metallothionein 2A)