MSRA (methionine sulfoxide reductase A)

Gene

• Entrez ID: 4482
• Gene name: Methionine sulfoxide reductase A
• Gene symbol: MSRA
• Synonyms (NCBI Gene): PMSR
• Chromosome: 8
• Chromosome location: 8p23.1
• Summary: This gene encodes a ubiquitous and highly conserved protein that carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. The protein func

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022647	hsa-miR-124-3p	Microarray	18668037
MIRT1161808	hsa-miR-1228	CLIP-seq
MIRT1161809	hsa-miR-198	CLIP-seq
MIRT1161810	hsa-miR-338-3p	CLIP-seq
MIRT1161811	hsa-miR-342-3p	CLIP-seq
MIRT1161812	hsa-miR-361-3p	CLIP-seq
MIRT1161813	hsa-miR-4267	CLIP-seq
MIRT1161814	hsa-miR-4421	CLIP-seq
MIRT1161815	hsa-miR-4530	CLIP-seq
MIRT1161816	hsa-miR-4793-5p	CLIP-seq
MIRT1161817	hsa-miR-615-5p	CLIP-seq
MIRT1161818	hsa-miR-330-3p	CLIP-seq
MIRT1161819	hsa-miR-4422	CLIP-seq
MIRT1161820	hsa-miR-4760-3p	CLIP-seq
MIRT2275499	hsa-miR-224	CLIP-seq
MIRT2275500	hsa-miR-23a	CLIP-seq
MIRT2275501	hsa-miR-23b	CLIP-seq
MIRT2275502	hsa-miR-23c	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006555	Process	Methionine metabolic process	TAS	10452521
GO:0006979	Process	Response to oxidative stress	TAS	10452521
GO:0008113	Function	Peptide-methionine (S)-S-oxide reductase activity	IBA
GO:0008113	Function	Peptide-methionine (S)-S-oxide reductase activity	IEA
GO:0008113	Function	Peptide-methionine (S)-S-oxide reductase activity	TAS	10452521
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0030091	Process	Protein repair	TAS
GO:0033744	Function	L-methionine:thioredoxin-disulfide S-oxidoreductase activity	IEA
GO:0034599	Process	Cellular response to oxidative stress	IBA
GO:0036211	Process	Protein modification process	TAS	10452521
GO:0036456	Function	L-methionine-(S)-S-oxide reductase activity	IBA
GO:0070062	Component	Extracellular exosome	HDA	19056867

Other IDs

• MIM: 601250
• HGNC: 7377
• e!Ensembl: ENSG00000175806

Protein

• UniProt ID: Q9UJ68
• Protein name: Mitochondrial peptide methionine sulfoxide reductase (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) (Protein-methionine-S-oxide reductase) (PMSR)
• Protein function: Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01625	PMSR	67 → 221	Peptide methionine sulfoxide reductase	Family

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. Highest expression in adult kidney and cerebellum, followed by liver, heart ventricles, bone marrow and hippocampus.
• Sequence:

  MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEP
  FPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVR
  VVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQ
  KVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK

• Sequence length: 235

Pathways

Reactome:

Protein repair

Associated diseases

Unknown
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
MSRA-related disorder	Uncertain significance; Likely benign; Benign	rs1171413366, rs77793822, rs139382033, rs199964551, rs374677955	RCV003418894 RCV003919865 RCV003911553 RCV003939492 RCV003966752

Associations from Text Mining
Disease Name	Relationship Type	References
Alzheimer Disease	Inhibit	10501213
Arthritis Rheumatoid	Associate	20617525
Atrial Remodeling	Associate	33578567
Carcinoma Hepatocellular	Inhibit	17784942
Carcinoma Pancreatic Ductal	Inhibit	35752173
Carotid Artery Diseases	Associate	33578567
Cataract	Associate	15199188
Cognition Disorders	Associate	27256292
Dementia	Associate	27256292
Neoplasm Metastasis	Inhibit	17784942
Neoplasm Metastasis	Associate	35752173
Neoplasms	Associate	25283348, 27321817
Neoplasms	Inhibit	35752173
Obesity	Associate	21674055, 22095114, 26828654, 27421018
Pulmonary Arterial Hypertension	Associate	33578567
Pulmonary Disease Chronic Obstructive	Associate	34674978
Thrombotic thrombocytopenic purpura acquired	Associate	27762046
Tuberculosis	Associate	36476775
Vitiligo	Inhibit	17943184