PEX39 (peroxisomal biogenesis factor 39)

Gene

• Entrez ID: 441150
• Gene name: Peroxisomal biogenesis factor 39
• Gene symbol: PEX39
• Synonyms (NCBI Gene): C6orf226
• Chromosome: 6
• Chromosome location: 6p21.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT851495	hsa-miR-1273g	CLIP-seq
MIRT851496	hsa-miR-1286	CLIP-seq
MIRT851497	hsa-miR-1290	CLIP-seq
MIRT851498	hsa-miR-194	CLIP-seq
MIRT851499	hsa-miR-323-5p	CLIP-seq
MIRT851500	hsa-miR-3672	CLIP-seq
MIRT851501	hsa-miR-4422	CLIP-seq
MIRT851502	hsa-miR-4436a	CLIP-seq
MIRT851503	hsa-miR-4495	CLIP-seq
MIRT851504	hsa-miR-4719	CLIP-seq
MIRT851505	hsa-miR-4722-5p	CLIP-seq
MIRT851506	hsa-miR-494	CLIP-seq
MIRT851507	hsa-miR-876-3p	CLIP-seq
MIRT1952502	hsa-miR-4790-3p	CLIP-seq
MIRT851497	hsa-miR-1290	CLIP-seq
MIRT2190341	hsa-miR-3169	CLIP-seq
MIRT2190342	hsa-miR-4740-5p	CLIP-seq
MIRT851506	hsa-miR-494	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 29892012, 31515488, 32296183
GO:0005777	Component	Peroxisome	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q5I0X4
• Protein name: Peroxisomal biogenesis factor 39
• Protein function: May be a peroxin involved in the PTS2-mediated protein import pathway.
• Sequence:

  MERPRSPQCSAPASASASVTLAQLLQLVQQGQELPGLEKRHIAAIHGEPTASRLPRRPKP
  WEAAALAESLPPPTLRIGTAPAEPGLVEAATAPSSWHTVGP

• Sequence length: 101

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULAR SARCOIDOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations