Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	440
Gene name	Asparagine synthetase (glutamine-hydrolyzing)
Gene symbol	ASNS
Synonyms (NCBI Gene)	ASNSDTS11
Chromosome	7
Chromosome location	7q21.3
Summary	The protein encoded by this gene is involved in the synthesis of asparagine. This gene complements a mutation in the temperature-sensitive hamster mutant ts11, which blocks progression through the G1 phase of the cell cycle at nonpermissive temperature. A

Show/Hide all (18)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020723	hsa-miR-155-5p	Proteomics	18668040
MIRT029495	hsa-miR-26b-5p	Microarray	19088304
MIRT031665	hsa-miR-16-5p	Proteomics	18668040
MIRT050820	hsa-miR-17-5p	CLASH	23622248
MIRT050405	hsa-miR-23a-3p	CLASH	23622248
MIRT047059	hsa-miR-183-5p	CLASH	23622248
MIRT040401	hsa-miR-615-3p	CLASH	23622248
MIRT803084	hsa-miR-219-1-3p	CLIP-seq
MIRT803085	hsa-miR-23a	CLIP-seq
MIRT803086	hsa-miR-23b	CLIP-seq
MIRT803087	hsa-miR-23c	CLIP-seq
MIRT803088	hsa-miR-3120-3p	CLIP-seq
MIRT803089	hsa-miR-3160-5p	CLIP-seq
MIRT803090	hsa-miR-323-3p	CLIP-seq
MIRT803091	hsa-miR-4289	CLIP-seq
MIRT803092	hsa-miR-4522	CLIP-seq
MIRT803093	hsa-miR-4682	CLIP-seq
MIRT803094	hsa-miR-571	CLIP-seq

Show/Hide all (7)

Transcription factor	Regulation	Reference
ATF3	Activation	12881527
ATF3	Unknown	15385533
ATF4	Activation	11960987;16164412;17276738
ATF4	Unknown	15385533;23403946
CEBPB	Unknown	15385533
DDIT3	Repression	18940792
WWTR1	Repression	22470139

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004066	Function	Asparagine synthase (glutamine-hydrolyzing) activity	IBA
GO:0004066	Function	Asparagine synthase (glutamine-hydrolyzing) activity	IDA	2564390, 2569668, 2573597, 2886907, 16023613
GO:0004066	Function	Asparagine synthase (glutamine-hydrolyzing) activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 31515488, 32296183
GO:0005524	Function	ATP binding	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006529	Process	Asparagine biosynthetic process	IBA
GO:0006529	Process	Asparagine biosynthetic process	IC	2564390
GO:0006529	Process	Asparagine biosynthetic process	IDA	2573597
GO:0006529	Process	Asparagine biosynthetic process	IEA
GO:0008652	Process	Amino acid biosynthetic process	IEA
GO:0016874	Function	Ligase activity	IEA
GO:0042149	Process	Cellular response to glucose starvation	IDA	10085239
GO:0043066	Process	Negative regulation of apoptotic process	IMP	17409444
GO:0045931	Process	Positive regulation of mitotic cell cycle	IDA	2569668
GO:0070981	Process	L-asparagine biosynthetic process	IEA

MIM	HGNC	e!Ensembl
108370	753	ENSG00000070669

P08243

Protein name

Asparagine synthetase [glutamine-hydrolyzing] (EC 6.3.5.4) (Cell cycle control protein TS11) (Glutamine-dependent asparagine synthetase)

PDB

6GQ3 , 8SUE , 9B6C

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13537	GATase_7	47 → 166	Glutamine amidotransferase domain	Domain
PF00733	Asn_synthase	234 → 395	Asparagine synthase	Domain
PF00733	Asn_synthase	381 → 547	Asparagine synthase	Domain

Sequence

MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQ
PIRVKKYPYLWLCYNGEIYNHKKMQQHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGV
FAFVLLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPF
LPGHYEVLDLKPNGKVASVEMVKYHHCRDVPLHALYDNVEKLFPGFEIETVKNNLRILFN
NAVKKRLMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQVQYPLQTFAIGMEDSPDLLAAR
KVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVV
IFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPF
LDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNS
WFKILQEYVEHQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYWMPK
WINATDPSARTLTHYKSAVKA

Sequence length

561

Interactions

View interactions

	KEGG		Reactome
	Alanine, aspartate and glutamate metabolism Metabolic pathways Biosynthesis of amino acids		Aspartate and asparagine metabolism

170

Show/Hide Causal Diseases (7)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Abnormal cerebral morphology	Likely pathogenic	rs2115592556, rs1230123411, rs781082812	RCV002275912 RCV002276344 RCV002275467
ASNS-related disorder	Pathogenic; Likely pathogenic	rs1792123022, rs373645939	RCV004731304 RCV004755930
Congenital microcephaly - severe encephalopathy - progressive cerebral atrophy syndrome	Likely pathogenic; Pathogenic	rs2115755676, rs1488937281, rs774808316, rs2115616730, rs797045306, rs747624770, rs1791584683, rs866033169, rs1166271142, rs2115654584, rs1399973379, rs2115649690, rs1183100703, rs201209327, rs2484630568 View all (30 more)	RCV001826128 RCV005038197 RCV001806244 RCV001780647 RCV001806448 RCV001806449 RCV003225983 RCV002307802 RCV004798935 RCV002282616 RCV003992600 RCV002284991 RCV002288413 RCV002510370 RCV005032346 RCV000193384 RCV003130394 RCV003226043 RCV003226880 RCV003226881 RCV003324266 RCV004701751 RCV005636991 RCV005033945 RCV001833514 RCV000714524 RCV005034018 RCV000503815 RCV002244973 RCV000625792 RCV000656456 RCV000656457 RCV000761483 RCV000985226 RCV000985208 RCV000984516 RCV001255830 RCV005036327 RCV002489588 RCV001090001 RCV003155373 RCV002497763 RCV001265595 RCV000077748 RCV000077749 RCV000077750 RCV001283833
Gastric cancer	Likely pathogenic; Pathogenic	rs769236847	RCV005896681
Neurodevelopmental delay	Pathogenic; Likely pathogenic	rs2115753664, rs769236847	RCV002274316 RCV002274029
Pancreatic adenocarcinoma	Likely pathogenic; Pathogenic	rs769236847	RCV005896680
Spinocerebellar ataxia, autosomal recessive 29	Likely pathogenic	rs774808316	RCV004813181

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Familial cancer of breast	Likely benign	rs761978438	RCV005912707
Hepatocellular carcinoma	Benign	rs2074891	RCV005924636
Malignant lymphoma, large B-cell, diffuse	Benign	rs2074891	RCV005924637
Neurodevelopmental abnormality	Conflicting classifications of pathogenicity; Uncertain significance	rs754043007, rs1792113146	RCV001264715 RCV001264714
Ovarian serous cystadenocarcinoma	Likely benign	rs761978438	RCV005912708

Show/Hide Text Mining Associations (29)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	31551255
Atrophy	Associate	26318253
Barrett Esophagus	Associate	33491460
Blindness Cortical	Associate	27422383
Brain Diseases	Associate	25227173, 32481472
Carcinoma Hepatocellular	Inhibit	28629319
Carcinoma Hepatocellular	Associate	28629319, 30176945, 32746792
Carcinoma Pancreatic Ductal	Associate	37814011
Diabetic Foot	Associate	38287255
Drug Hypersensitivity	Associate	24907114
Esophageal Squamous Cell Carcinoma	Associate	32174781
Hyperekplexia	Associate	27422383
Leukemia	Associate	17380207, 19414379, 21972289, 34535013
Leukemia Biphenotypic Acute	Associate	37839090
Microcephaly	Associate	25227173, 27422383, 32481472
Mitochondrial Myopathies	Stimulate	35850946
Nasopharyngeal Carcinoma	Associate	23956056
Neoplasm Metastasis	Stimulate	32174781
Neoplasms	Associate	30061420, 37111157
Neoplasms	Stimulate	32174781
Neoplasms Second Primary	Associate	32447501
Osteosarcoma	Associate	37528150
Ovarian Neoplasms	Associate	18852115
Pancreatitis	Associate	24907114
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	17380207, 19054556, 21972289, 28003999
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	34535013, 37280363, 37839090
Prostatic Neoplasms	Associate	38206293
Pulmonary Disease Chronic Obstructive	Associate	37710311
Rectal Neoplasms	Associate	24729124

ASNS (asparagine synthetase (glutamine-hydrolyzing))