Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4357
Gene name Gene Name - the full gene name approved by the HGNC.	Mercaptopyruvate sulfurtransferase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MPST
Synonyms (NCBI Gene) Gene synonyms aliases	MST, TST2, TUM1
Chromosome Chromosome number	22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	22q12.3
Summary Summary of gene provided in NCBI Entrez Gene.	This protein encoded by this gene catalyzes the transfer of a sulfur ion from 3-mercaptopyruvate to cyanide or other thiol compounds. It may be involved in cysteine degradation and cyanide detoxification. There is confusion in literature between this prot

Show/Hide all(20)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016463	hsa-miR-193b-3p	Microarray	20304954
MIRT021491	hsa-miR-191-5p	Sequencing	20371350
MIRT1156968	hsa-miR-298	CLIP-seq
MIRT1156969	hsa-miR-4633-3p	CLIP-seq
MIRT2274152	hsa-miR-105	CLIP-seq
MIRT2274153	hsa-miR-1273f	CLIP-seq
MIRT2274154	hsa-miR-1343	CLIP-seq
MIRT2274155	hsa-miR-143	CLIP-seq
MIRT2274156	hsa-miR-191	CLIP-seq
MIRT2274157	hsa-miR-219-1-3p	CLIP-seq
MIRT2274158	hsa-miR-3176	CLIP-seq
MIRT2274159	hsa-miR-3622a-3p	CLIP-seq
MIRT2274160	hsa-miR-3622b-3p	CLIP-seq
MIRT2274161	hsa-miR-3922-3p	CLIP-seq
MIRT2274162	hsa-miR-4682	CLIP-seq
MIRT2274163	hsa-miR-4708-5p	CLIP-seq
MIRT2274164	hsa-miR-4715-3p	CLIP-seq
MIRT2274165	hsa-miR-4770	CLIP-seq
MIRT2274166	hsa-miR-571	CLIP-seq
MIRT2274167	hsa-miR-95	CLIP-seq

Show/Hide all(31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000098	Process	Sulfur amino acid catabolic process	IEA
GO:0000098	Process	Sulfur amino acid catabolic process	TAS
GO:0001822	Process	Kidney development	IEA
GO:0001889	Process	Liver development	IEA
GO:0004792	Function	Thiosulfate-cyanide sulfurtransferase activity	IBA
GO:0004792	Function	Thiosulfate-cyanide sulfurtransferase activity	IEA
GO:0004792	Function	Thiosulfate-cyanide sulfurtransferase activity	TAS
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0009440	Process	Cyanate catabolic process	IEA
GO:0009440	Process	Cyanate catabolic process	TAS
GO:0009636	Process	Response to toxic substance	TAS
GO:0016740	Function	Transferase activity	IEA
GO:0016783	Function	Sulfurtransferase activity	IEA
GO:0016784	Function	3-mercaptopyruvate sulfurtransferase activity	IBA
GO:0016784	Function	3-mercaptopyruvate sulfurtransferase activity	IEA
GO:0016784	Function	3-mercaptopyruvate sulfurtransferase activity	ISS
GO:0016784	Function	3-mercaptopyruvate sulfurtransferase activity	TAS
GO:0019346	Process	Transsulfuration	IEA
GO:0021510	Process	Spinal cord development	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043005	Component	Neuron projection	ISS
GO:0045202	Component	Synapse	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070814	Process	Hydrogen sulfide biosynthetic process	IEA
GO:0070814	Process	Hydrogen sulfide biosynthetic process	ISS

MIM	HGNC	e!Ensembl
602496	7223	ENSG00000128309

Protein

UniProt ID

P25325

Protein name

3-mercaptopyruvate sulfurtransferase (MST) (EC 2.8.1.2)

Protein function

Transfer of a sulfur ion to cyanide or to other thiol compounds. Also has weak rhodanese activity. Detoxifies cyanide and is required for thiosulfate biosynthesis. Acts as an antioxidant. In combination with cysteine aminotransferase (CAT), cont

PDB

3OLH , 4JGT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00581	Rhodanese	12 → 138	Rhodanese-like domain	Domain
PF00581	Rhodanese	165 → 282	Rhodanese-like domain	Domain

Sequence

MASPQLCRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRDARREFEERHIPGAAFF
DIDQCSDRTSPYDHMLPGAEHFAEYAGRLGVGAATHVVIYDASDQGLYSAPRVWWMFRAF
GHHAVSLLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQLDPAFIKTYEDIKENLESRRFQV
VDSRATGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLSQEGLEKSPEEIRHLFQEKKVDL
SKPLVATCGSGVTACHVALGAYLCGKPDVPIYDGSWVEWYMRARPEDVISEGRGKTH

Sequence length

297

Interactions

View interactions

	KEGG		Reactome
	Cysteine and methionine metabolism Sulfur metabolism Metabolic pathways Sulfur relay system		Degradation of cysteine and homocysteine

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Encephalopathy	Encephalopathy due to beta-mercaptolactate-cysteine disulfiduria	N/A	N/A	ClinVar

Show/Hide Text Mining Associations (16)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Carcinoma Renal Cell	Associate	32871814
Chronic Limb Threatening Ischemia	Inhibit	25977470
Colonic Diseases	Associate	38631098
Colorectal Neoplasms	Inhibit	16500920
Colorectal Neoplasms	Associate	36113340, 38631098
Down Syndrome	Associate	32340322
Gastrointestinal Neoplasms	Associate	38631098
Inflammation	Stimulate	33554726
Kidney Neoplasms	Associate	29793450
Melanoma	Associate	37892173, 38070581
Mitochondrial Diseases	Associate	32340322
Neoplasms	Associate	36113340
Neuroblastoma	Associate	28291844
Neurodegenerative Diseases	Associate	33296712
Neuroendocrine Tumors	Associate	40217502
Urethral Neoplasms	Associate	35605291

MPST (mercaptopyruvate sulfurtransferase)