MPO (myeloperoxidase)

Gene

• Entrez ID: 4353
• Gene name: Myeloperoxidase
• Gene symbol: MPO
• Synonyms (NCBI Gene): -
• Chromosome: 17
• Chromosome location: 17q22
• Summary: Myeloperoxidase (MPO) is a heme protein synthesized during myeloid differentiation that constitutes the major component of neutrophil azurophilic granules. Produced as a single chain precursor, myeloperoxidase is subsequently cleaved into a light and heav

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs35897051	T>G	Pathogenic	Splice acceptor variant
rs78950939	T>C	Pathogenic	Missense variant, coding sequence variant
rs119468010	G>A	Pathogenic	Coding sequence variant, missense variant
rs119469012	A>C,G	Pathogenic	Coding sequence variant, missense variant
rs119469013	C>A,T	Pathogenic	Coding sequence variant, missense variant
rs119469014	G>A,C	Pathogenic	Coding sequence variant, missense variant
rs536522394	TTGGGTTCCATGGG>-,TTGGGTTCCATGGGTTGGGTTCCATGGG	Pathogenic, pathogenic-likely-pathogenic	Frameshift variant, coding sequence variant
rs762933005	G>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs778013714	C>A	Likely-pathogenic	Stop gained, coding sequence variant
rs1555607599	A>G	Likely-pathogenic	Splice donor variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT532437	hsa-miR-8485	PAR-CLIP	20371350
MIRT532436	hsa-miR-1324	PAR-CLIP	20371350
MIRT532435	hsa-miR-4716-5p	PAR-CLIP	20371350
MIRT532437	hsa-miR-8485	PAR-CLIP	22012620
MIRT532436	hsa-miR-1324	PAR-CLIP	22012620
MIRT532435	hsa-miR-4716-5p	PAR-CLIP	22012620
MIRT532436	hsa-miR-1324	PAR-CLIP	26701625
MIRT532436	hsa-miR-1324	PAR-CLIP	26701625
MIRT532436	hsa-miR-1324	PAR-CLIP	26701625
MIRT532436	hsa-miR-1324	PAR-CLIP	26701625
MIRT532436	hsa-miR-1324	PAR-CLIP	26701625
MIRT532436	hsa-miR-1324	PAR-CLIP	26701625
MIRT532436	hsa-miR-1324	PAR-CLIP	26701625
MIRT532436	hsa-miR-1324	PAR-CLIP	26701625
MIRT532435	hsa-miR-4716-5p	PAR-CLIP	26701625
MIRT532435	hsa-miR-4716-5p	PAR-CLIP	26701625
MIRT532435	hsa-miR-4716-5p	PAR-CLIP	26701625
MIRT532435	hsa-miR-4716-5p	PAR-CLIP	26701625
MIRT532435	hsa-miR-4716-5p	PAR-CLIP	26701625
MIRT532435	hsa-miR-4716-5p	PAR-CLIP	26701625
MIRT532435	hsa-miR-4716-5p	PAR-CLIP	26701625
MIRT532435	hsa-miR-4716-5p	PAR-CLIP	26701625
MIRT532437	hsa-miR-8485	PAR-CLIP	26701625
MIRT532437	hsa-miR-8485	PAR-CLIP	26701625
MIRT532437	hsa-miR-8485	PAR-CLIP	26701625
MIRT532437	hsa-miR-8485	PAR-CLIP	26701625
MIRT532437	hsa-miR-8485	PAR-CLIP	26701625
MIRT532437	hsa-miR-8485	PAR-CLIP	26701625
MIRT532437	hsa-miR-8485	PAR-CLIP	26701625
MIRT532437	hsa-miR-8485	PAR-CLIP	26701625
MIRT532436	hsa-miR-1324	PAR-CLIP	27292025
MIRT532436	hsa-miR-1324	PAR-CLIP	27292025
MIRT532436	hsa-miR-1324	PAR-CLIP	27292025
MIRT532435	hsa-miR-4716-5p	PAR-CLIP	27292025
MIRT532435	hsa-miR-4716-5p	PAR-CLIP	27292025
MIRT532435	hsa-miR-4716-5p	PAR-CLIP	27292025
MIRT532437	hsa-miR-8485	PAR-CLIP	27292025
MIRT532437	hsa-miR-8485	PAR-CLIP	27292025
MIRT532437	hsa-miR-8485	PAR-CLIP	27292025
MIRT532437	hsa-miR-8485	PAR-CLIP	20371350
MIRT532436	hsa-miR-1324	PAR-CLIP	20371350
MIRT532435	hsa-miR-4716-5p	PAR-CLIP	20371350
MIRT532437	hsa-miR-8485	PAR-CLIP	22012620
MIRT532436	hsa-miR-1324	PAR-CLIP	22012620
MIRT532435	hsa-miR-4716-5p	PAR-CLIP	22012620
MIRT1156259	hsa-miR-3646	CLIP-seq
MIRT1156260	hsa-miR-3907	CLIP-seq
MIRT1156261	hsa-miR-3915	CLIP-seq
MIRT1156262	hsa-miR-3928	CLIP-seq
MIRT1156263	hsa-miR-451b	CLIP-seq
MIRT1156264	hsa-miR-4694-3p	CLIP-seq
MIRT1156265	hsa-miR-4710	CLIP-seq
MIRT1156266	hsa-miR-522	CLIP-seq
MIRT1156260	hsa-miR-3907	CLIP-seq
MIRT2273957	hsa-miR-3194-3p	CLIP-seq
MIRT1156260	hsa-miR-3907	CLIP-seq
MIRT2273958	hsa-miR-4267	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
RUNX1	Unknown	11023523
SP1	Activation	17521322;8662930
SP1	Unknown	12057865

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001878	Process	Response to yeast	IEA
GO:0002149	Process	Hypochlorous acid biosynthetic process	IEA
GO:0002679	Process	Respiratory burst involved in defense response	IEA
GO:0003682	Function	Chromatin binding	TAS	2829220
GO:0004601	Function	Peroxidase activity	IBA	21873635
GO:0004601	Function	Peroxidase activity	IDA	10772654, 11907569, 24035742
GO:0005515	Function	Protein binding	IPI	24355864, 32814053
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	10772654, 25645918
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005654	Component	Nucleoplasm	IDA
GO:0005764	Component	Lysosome	TAS	8621627
GO:0006952	Process	Defense response	TAS	8621627
GO:0006979	Process	Response to oxidative stress	TAS	2903767
GO:0007568	Process	Aging	IEA
GO:0008201	Function	Heparin binding	IDA	11907569
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0019430	Process	Removal of superoxide radicals	IEA
GO:0020037	Function	Heme binding	IEA
GO:0030141	Component	Secretory granule	IDA	11907569
GO:0032094	Process	Response to food	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0034374	Process	Low-density lipoprotein particle remodeling	IDA	10772654
GO:0035578	Component	Azurophil granule lumen	TAS
GO:0042582	Component	Azurophil granule	IDA	2981589
GO:0042742	Process	Defense response to bacterium	IBA	21873635
GO:0042744	Process	Hydrogen peroxide catabolic process	IDA	10772654, 11907569
GO:0043066	Process	Negative regulation of apoptotic process	TAS	10801811
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0045454	Process	Cell redox homeostasis	TAS
GO:0046872	Function	Metal ion binding	IEA
GO:0050832	Process	Defense response to fungus	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0097013	Component	Phagocytic vesicle lumen	TAS
GO:1990268	Process	Response to gold nanoparticle	IEA

Other IDs

• MIM: 606989
• HGNC: 7218
• e!Ensembl: ENSG00000005381

Protein

• UniProt ID: P05164
• Protein name: Myeloperoxidase (MPO) (EC 1.11.2.2) [Cleaved into: Myeloperoxidase; 89 kDa myeloperoxidase; 84 kDa myeloperoxidase; Myeloperoxidase light chain; Myeloperoxidase heavy chain]
• Protein function: Part of the host defense system of polymorphonuclear leukocytes. It is responsible for microbicidal activity against a wide range of organisms. In the stimulated PMN, MPO catalyzes the production of hypohalous acids, primarily hypochlorous acid
• PDB: 1CXP, 1D2V, 1D5L, 1D7W, 1DNU, 1DNW, 1MHL, 1MYP, 3F9P, 3ZS0, 3ZS1, 4C1M, 4DL1, 4EJX, 5FIW, 5MFA, 5UZU, 6AZP, 6BMT, 7OIH
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03098	An_peroxidase	173 → 718	Animal haem peroxidase	Domain

• Sequence:

  MGVPFFSSLRCMVDLGPCWAGGLTAEMKLLLALAGLLAILATPQPSEGAAPAVLGEVDTS
  LVLSSMEEAKQLVDKAYKERRESIKQRLRSGSASPMELLSYFKQPVAATRTAVRAADYLH
  VALDLLERKLRSLWRRPFNVTDVLTPAQLNVLSKSSGCAYQDVGVTCPEQDKYRTITGMC
  NNRRSPTLGASNRAFVRWLPAEYEDGFSLPYGWTPGVKRNGFPVALARAVSNEIVRFPTD
  QLTPDQERSLMFMQWGQLLDHDLDFTPEPAARASFVTGVNCETSCVQQPPCFPLKIPPND
  PRIKNQADCIPFFRSCPACPGSNITIRNQINALTSFVDASMVYGSEEPLARNLRNMSNQL
  GLLAVNQRFQDNGRALLPFDNLHDDPCLLTNRSARIPCFLAGDTRSSEMPELTSMHTLLL
  REHNRLATELKSLNPRWDGERLYQEARKIVGAMVQIITYRDYLPLVLGPTAMRKYLPTYR
  SYNDSVDPRIANVFTNAFRYGHTLIQPFMFRLDNRYQPMEPNPRVPLSRVFFASWRVVLE
  GGIDPILRGLMATPAKLNRQNQIAVDEIRERLFEQVMRIGLDLPALNMQRSRDHGLPGYN
  AWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPL
  LACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMS
  NSYPRDFVNCSTLPALNLASWREAS

• Sequence length: 745

Pathways

KEGG:

Drug metabolism - other enzymes
Phagosome
Neutrophil extracellular trap formation
Transcriptional misregulation in cancer
Acute myeloid leukemia

Reactome:

Neutrophil degranulation
Events associated with phagocytolytic activity of PMN cells

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Alzheimer disease	Familial Alzheimer Disease (FAD), Alzheimer Disease, Late Onset, Alzheimer Disease, Early Onset, Alzheimer`s Disease, Alzheimer`s Disease, Focal Onset	rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039, rs63750973, rs63749810, rs63750643, rs193922916, rs63750306, rs63750590, rs63750526, rs63751235, rs661, rs63751037, rs63749885, rs63750231, rs63751229, rs63751272, rs63751223, rs63750391, rs63751163, rs281875357, rs63751141, rs63750082, rs121917807, rs63751399, rs63750265, rs63751144, rs63750886, rs63751068, rs121917808, rs63749891, rs63750083, rs63749824, rs63750577, rs267606983, rs63750218, rs63751287, rs63750900, rs63751475, rs63750450, rs63749805, rs63751278, rs63751106, rs63750004, rs63749806, rs63751024, rs63750248, rs63750779, rs63751139, rs63750219, rs63750298, rs63750687, rs63750851, rs1553268799, rs1561901881, rs1561905293, rs866101707, rs1566638673, rs63750009, rs1566656702, rs1566657804, rs1567885728, rs1568339995, rs1566630791, rs1555358260, rs63750964, rs1594998354, rs63751316	15023809
Cholestasis	Cholestasis, Extrahepatic	rs121909103, rs751511532, rs376368459, rs762702807, rs1578490102, rs1578499691, rs1578504946, rs1317656688, rs199791850, rs1452792080, rs1578491039	28789951
Colorectal cancer	Colorectal Carcinoma	rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800, rs63750198, rs63751109, rs863223312, rs63750710, rs63751615, rs63750206, rs63750781, rs63750899, rs63750691, rs63750217, rs121912965, rs63749939, rs63751194, rs63750693, rs63750540, rs63751221, rs193922370, rs80359596, rs397514632, rs483352909, rs200495564, rs397514684, rs397516436, rs398122386, rs79512956, rs74953290, rs587779001, rs63750677, rs63749837, rs267607816, rs63751715, rs267607819, rs267607815, rs267607822, rs63749906, rs587778883, rs63750472, rs63751012, rs63750715, rs63750580, rs267607706, rs267607709, rs267607710, rs587778894, rs63750749, rs63750483, rs63751015, rs63751153, rs63751094, rs63751118, rs63750316, rs63749981, rs587778906, rs267607821, rs587778908, rs63750020, rs587778909, rs63750713, rs267607825, rs63751592, rs281864936, rs587778913, rs587778914, rs63749795, rs63750855, rs63749916, rs63749923, rs63751472, rs63751689, rs267607832, rs267607837, rs267607836, rs587778923, rs63750028, rs587778928, rs587778929, rs587778930, rs63751277, rs587778933, rs267607842, rs267607843, rs63750192, rs587778934, rs63750193, rs587778937, rs587778938, rs267607845, rs63751244, rs63751393, rs63751460, rs267607849, rs267607853, rs267607856, rs267607850, rs63751657, rs267607854, rs267607852, rs587778942, rs63750309, rs63750587, rs63749863, rs63751486, rs63750016, rs63749868, rs63750375, rs63750035, rs63750604, rs63750386, rs63750150, rs63750486, rs63751428, rs267607866, rs63749986, rs63751594, rs63750152, rs63750850, rs267607867, rs267607868, rs63751632, rs267607871, rs63751892, rs587778956, rs63750469, rs587778958, rs63749792, rs267607875, rs63751255, rs281864938, rs63751202, rs63750726, rs63751310, rs63749900, rs587778964, rs267607879, rs267607878, rs587778966, rs267607883, rs267607887, rs63750061, rs63750663, rs587778968, rs587778971, rs63750809, rs63749867, rs63750864, rs587778972, rs63751275, rs267607718, rs267607722, rs63750769, rs267607717, rs587778973, rs267607716, rs267607720, rs63749995, rs63750859, rs587778975, rs63750114, rs587778976, rs63750603, rs267607889, rs267607723, rs63750561, rs63750499, rs63751642, rs63751022, rs587778981, rs63750971, rs267607898, rs267607906, rs267607903, rs587778989, rs587778992, rs267607894, rs267607901, rs267607892, rs63750437, rs587778997, rs587778998, rs63750005, rs63750641, rs63751421, rs11541859, rs63750266, rs111052004, rs267607726, rs267607727, rs63750453, rs267607734, rs267607735, rs63751665, rs267607736, rs267607732, rs63749816, rs63750539, rs267607739, rs587779006, rs587779008, rs267607745, rs267607742, rs63751595, rs267607743, rs587779010, rs587779012, rs63750057, rs63749818, rs63751124, rs587779014, rs587779015, rs63749820, rs63751302, rs267607750, rs267607751, rs267607749, rs63750891, rs63749959, rs63749804, rs267607765, rs267607760, rs587779021, rs267607759, rs63750515, rs587779023, rs63751021, rs63751480, rs267607772, rs267607773, rs587779024, rs63751653, rs587779027, rs267607767, rs587779029, rs63750706, rs63750385, rs267607774, rs267607778, rs267607780, rs587779034, rs63751711, rs267607784, rs587779035, rs63750823, rs63750822, rs267607787, rs63750303, rs63749839, rs63749827, rs267607789, rs267607790, rs267607791, rs267607786, rs267607771, rs267607795, rs267607794, rs267607788, rs267607799, rs267607801, rs587779045, rs63750034, rs587779047, rs63750216, rs63751707, rs63751598, rs267607803, rs267607777, rs63750144, rs267607805, rs63750547, rs63750489, rs63750993, rs587779054, rs63751259, rs63749926, rs63750796, rs587779058, rs63750745, rs63750582, rs180177084, rs587779866, rs200389141, rs587779950, rs587780104, rs587780183, rs587778536, rs587780683, rs587781554, rs267607712, rs587777627, rs587783057, rs730881734, rs41542214, rs730881273, rs786203456, rs786201990, rs786202767, rs748005072, rs786204317, rs786204318, rs797045117, rs63750549, rs863225383, rs863225384, rs863225373, rs863225376, rs863225377, rs863225378, rs863225379, rs863225380, rs863225381, rs63750059, rs267607823, rs864622457, rs869312767, rs869312753, rs876661059, rs876658915, rs876658923, rs876660860, rs876660822, rs876660458, rs876660214, rs876658657, rs876658247, rs876659226, rs876658821, rs876660589, rs876659068, rs876659681, rs876659608, rs878853794, rs878853778, rs878853780, rs878853785, rs886039423, rs886039424, rs1057517543, rs1057517541, rs756843954, rs1057517617, rs1057517558, rs1057519256, rs1060500689, rs764085979, rs1060500707, rs1060500699, rs1060500706, rs1060500703, rs1064795341, rs1064793607, rs1064794348, rs1064795441, rs1064794373, rs1064793172, rs1064794122, rs1064795515, rs1064794331, rs63750978, rs1114167435, rs1553641362, rs63751448, rs1553648029, rs1553648058, rs587778903, rs1553653237, rs1553664353, rs267607744, rs1553647995, rs1553648047, rs1553653084, rs1553663750, rs1553664436, rs1553488015, rs1553637293, rs63750310, rs63750443, rs63751596, rs1553646681, rs550890395, rs1064796057, rs1553642079, rs1553648023, rs587782087, rs746536721, rs1553653037, rs1248251121, rs1553646602, rs1434898623, rs1553665683, rs1553648068, rs1553645331, rs1553644123, rs1553658246, rs1553651299, rs1553648149, rs1553663159, rs1302248679, rs1553664119, rs1553658009, rs1553665977, rs1416171624, rs1553663834, rs1553664617, rs1553664702, rs1553647969, rs1553648040, rs1437454428, rs1553641273, rs63751101, rs1553646764, rs1553648225, rs1554082118, rs1553648201, rs1553638868, rs1553665866, rs376736188, rs1553642707, rs1553645226, rs1553652883, rs63751435, rs1553653115, rs1553653195, rs63750300, rs1553662622, rs1553658104, rs1553648220, rs1559544064, rs63750584, rs267608083, rs1559551570, rs1559575107, rs1559553501, rs1565986506, rs1559524405, rs1559553492, rs1559554339, rs1559588540, rs1559558071, rs761329565, rs1559521039, rs1559574795, rs1567221417, rs1559578422, rs1481129490, rs1570714352, rs779783209, rs1575376830, rs1575469070, rs1575537843, rs1575620443, rs1575621506, rs587779022, rs1575414904, rs1575449093, rs1575469505, rs1575536254, rs1575537933, rs1575632112, rs1575639851, rs1575441094, rs1575449402, rs267607831, rs2081922847, rs2083403132, rs2085415927, rs2085469647, rs2043913790, rs147542208
Epileptic encephalopathy	Encephalopathies	rs587776508, rs121918334, rs121918317, rs121918321, rs74315390, rs28939684, rs74315391, rs74315392, rs118192244, rs121918622, rs121918623, rs121917953, rs121917955, rs121918624, rs121918625, rs121918626, rs121918629, rs121918632, rs118192218, rs118192219, rs118192222, rs118192226, rs118192228, rs118192234, rs118192236, rs118192235, rs118192242, rs118192185, rs118192188, rs118192246, rs118192186, rs118192194, rs118192199, rs118192201, rs118192202, rs118192203, rs118192204, rs118192205, rs118192206, rs118192208, rs118192215, rs118192216, rs118192239, rs397514458, rs387906686, rs202151337, rs121917957, rs121917929, rs121917927, rs121917966, rs121917941, rs121917964, rs121917943, rs121917965, rs121917918, rs121917963, rs121917911, rs121917912, rs121917986, rs121917987, rs121917913, rs121917945, rs121917996, rs121917975, rs121917919, rs121917993, rs121917915, rs121917995, rs121917976, rs121917994, rs121917926, rs121917951, rs121917952, rs121917980, rs121917921, rs121917935, rs121917936, rs121917984, rs121917937, rs121917985, rs121917938, rs121917928, rs121918753, rs121918781, rs121918782, rs121918784, rs121918734, rs121918788, rs121917969, rs121918775, rs121918786, rs121918796, rs121918745, rs121918740, rs121918741, rs121918789, rs121918742, rs121918791, rs121918811, rs121917922, rs121918744, rs121918778, rs121918767, rs121918779, rs121918770, rs121918783, rs121918773, rs121918793, rs267606051, rs398123585, rs398123588, rs398123593, rs587777164, rs587777219, rs587777310, rs587780446, rs587777492, rs587777495, rs587777577, rs267608501, rs587777721, rs587783192, rs587783200, rs104894745, rs587784453, rs587784454, rs587784438, rs587784440, rs727504136, rs727503974, rs727504140, rs727504173, rs201497300, rs786204967, rs794726739, rs794726845, rs779614747, rs794726726, rs794726763, rs794726754, rs794726760, rs794726759, rs199727342, rs794726800, rs794726752, rs794726825, rs794726809, rs794726696, rs794726699, rs794726705, rs794726784, rs794726779, rs794726821, rs146878122, rs794726816, rs794726744, rs794726854, rs794726710, rs794726733, rs542420576, rs794726772, rs794726842, rs794726718, rs794726761, rs794726697, rs794726775, rs397514459, rs767045134, rs794726766, rs794726742, rs794726730, rs794726778, rs794726736, rs794726773, rs794726790, rs794726826, rs794726753, rs794726799, rs794726844, rs794726782, rs794726798, rs794726824, rs794726827, rs794726803, rs794726711, rs794726762, rs786205598, rs863223345, rs794727128, rs794727337, rs794727361, rs794727444, rs794727740, rs794727792, rs794727970, rs863225068, rs796053181, rs796053130, rs796053048, rs796053086, rs796053103, rs796053043, rs796053085, rs796053035, rs796053031, rs796053029, rs796053022, rs139300715, rs796053014, rs1553522472, rs796053010, rs121917908, rs796053008, rs794726789, rs796053004, rs796053072, rs796052995, rs796053067, rs796052990, rs796052987, rs796052985, rs796053065, rs1553543316, rs796053064, rs796052977, rs796052976, rs796052973, rs796052972, rs781746113, rs796052960, rs796052959, rs796053054, rs1553551312, rs796052953, rs758871507, rs796053350, rs1554776228, rs796053352, rs796053390, rs796053353, rs796053359, rs796053361, rs796053366, rs796053367, rs796053370, rs796053368, rs796053373, rs796053376, rs796053377, rs1554768992, rs796053335, rs796053233, rs796053214, rs796053216, rs796053224, rs796053228, rs796053229, rs796052658, rs796052670, rs796052654, rs796052653, rs796052652, rs773171451, rs1555853593, rs759584387, rs796052650, rs118192233, rs796052657, rs796052644, rs796052645, rs796052641, rs796052640, rs775918190, rs796052636, rs796052626, rs796052623, rs796052621, rs796052620, rs796052618, rs796052617, rs796052663, rs797044983, rs797045013, rs797044878, rs797044951, rs797044873, rs797044938, rs797045969, rs118192212, rs863225037, rs863225036, rs863225030, rs863225031, rs864321707, rs864321712, rs869312684, rs869312920, rs869312939, rs878853250, rs878854263, rs878854262, rs751170778, rs878854974, rs878855236, rs1555794286, rs879255652, rs879255695, rs879255697, rs879255704, rs879255705, rs879255709, rs879255710, rs886039323, rs886039435, rs886039494, rs886039903, rs1135401734, rs1135401733, rs1135401732, rs886042004, rs886041716, rs886041961, rs886041668, rs886041246, rs886041339, rs886041766, rs886041262, rs886041715, rs886042528, rs886042605, rs886063501, rs1555850151, rs1057516123, rs1555853971, rs1057516115, rs1057516106, rs1057516105, rs1057516099, rs1057516098, rs1057516094, rs1057516089, rs1057516086, rs1057516085, rs1057516080, rs1057516079, rs1057516076, rs1057518325, rs1057517862, rs1057517849, rs1057518243, rs1057518258, rs1057517958, rs121917974, rs1057517959, rs796053374, rs1057517919, rs1057518489, rs1057518801, rs1057518816, rs759766243, rs1057518795, rs1057518985, rs1057519000, rs1057519269, rs1057519270, rs1057519452, rs375659415, rs1057519501, rs1057519528, rs1057519526, rs1057519527, rs1057519524, rs796053083, rs1057519529, rs1057519531, rs1057519547, rs1057519548, rs1057519545, rs1057519538, rs1057519539, rs1057519537, rs1057519540, rs1057519549, rs1057519550, rs1057519535, rs1057519536, rs1057519542, rs778291283, rs1057520486, rs794726765, rs750209664, rs121917753, rs1057521746, rs1057523858, rs1057520753, rs1057520413, rs1057521080, rs1057524599, rs778481061, rs768633670, rs796052655, rs1060502190, rs1060502183, rs121918780, rs1060502185, rs1057521537, rs1060502187, rs121918765, rs1060502182, rs121917981, rs1060502188, rs1060502189, rs1060503108, rs1060501724, rs1060501722, rs1060501723, rs1060501012, rs1060504137, rs1060500603, rs1060500602, rs1060499592, rs796053138, rs1064795579, rs1553520298, rs121918805, rs1064795733, rs1064796177, rs1064795735, rs1064794634, rs1064796384, rs1064796213, rs1064793923, rs1064794727, rs1064794533, rs1064795384, rs1555850842, rs1064794001, rs1064796151, rs1064795435, rs1064797284, rs1085307930, rs1085307730, rs1085307916, rs1085307876, rs1085307920, rs1131691773, rs1131691774, rs1131691675, rs1131691775, rs1131691693, rs1131691465, rs1131691830, rs1131691936, rs1057523728, rs1199412903, rs1555228303, rs1555507477, rs1554965669, rs1555499800, rs1553923787, rs922847767, rs368609628, rs1553286282, rs1266877537, rs794726749, rs1553551425, rs1553552390, rs1554778657, rs1555889130, rs1555881741, rs1553520320, rs1553522517, rs796053006, rs1553534296, rs1553541028, rs1553544579, rs1553551385, rs1553520380, rs1553525210, rs1553541473, rs761333438, rs1553520982, rs1553522321, rs1553520318, rs1553540503, rs1553540389, rs1553542199, rs1553543215, rs1553541172, rs1553549483, rs750901301, rs794726743, rs1553545660, rs1553561023, rs1553548096, rs1553552319, rs1553560760, rs1554037381, rs1554776948, rs1554778417, rs1057522982, rs1555219147, rs1555218657, rs1555850590, rs1555869758, rs1555873823, rs1553525325, rs794727813, rs1555228771, rs1553520530, rs1555870346, rs1555955296, rs1553551493, rs1555546796, rs1555870554, rs1555871832, rs77216276, rs1554689320, rs1554777496, rs1555881809, rs1553529461, rs12131800, rs1553517274, rs1555889127, rs1555951141, rs1553590192, rs1553531178, rs1555870470, rs927722314, rs1553523142, rs1041924436, rs1553544559, rs1553544821, rs1553520319, rs1553560677, rs1553521567, rs1553522331, rs1553519872, rs1553529426, rs1553519902, rs1553520029, rs1553545522, rs1553520439, rs146515561, rs1553549461, rs1553549834, rs1553546789, rs1553553614, rs1553560676, rs1553520227, rs1553524865, rs1553525036, rs1553560740, rs1553561016, rs1193718145, rs1554769099, rs936639741, rs1352024223, rs758779535, rs1555870506, rs747376305, rs1555869700, rs1555873656, rs1555873981, rs536000212, rs959316981, rs1554777470, rs1555889108, rs1559144583, rs1569219844, rs1564346538, rs1562159088, rs1559101839, rs1559114303, rs1559140110, rs1559140306, rs1043031572, rs121918756, rs1559199628, rs1559200672, rs796053095, rs1559210063, rs1559225495, rs1553549471, rs1559103294, rs1559105368, rs121918764, rs1559114837, rs1559122124, rs1559127505, rs1559128532, rs1559140855, rs1559149128, rs1559217391, rs1559220874, rs794726695, rs1559249734, rs1553553527, rs1559101585, rs1559110846, rs1559193050, rs1559216338, rs1559231284, rs148442069, rs1559105301, rs1559114202, rs121917954, rs1559195296, rs1553546763, rs1559238432, rs1559884460, rs1559887808, rs1564352002, rs1564349850, rs1564351103, rs1565933795, rs1565886685, rs1555228668, rs587777723, rs1564333757, rs375363057, rs1568932480, rs1568925719, rs770187706, rs1568864658, rs1568899375, rs118192209, rs1568932462, rs1568927747, rs1057518555, rs1559119345, rs1085307520, rs1559200901, rs970867558, rs1568940442, rs775162839, rs1568986619, rs1558308998, rs1553546668, rs1569017015, rs1569017045, rs1569017073, rs1555889090, rs1569017143, rs1569017148, rs1569017205, rs1179351306, rs1569017257, rs1569017337, rs1555889162, rs1568658507, rs1485894376, rs1561139569, rs1574716488, rs1553519865, rs1573946994, rs1573948129, rs121918812, rs1573950349, rs1573952908, rs1573964264, rs1573964628, rs372425457, rs1573984004, rs1574004452, rs1574005235, rs1574006637, rs1574006857, rs1574039742, rs121918801, rs1574051496, rs1574051665, rs1574060250, rs1574060717, rs1574169179, rs1574170908, rs121918774, rs1574192005, rs1574192998, rs1574201591, rs1574216450, rs1574223964, rs1574224274, rs1574225593, rs748267258, rs1553547380, rs1574263819, rs1574265144, rs762927460, rs1574266490, rs1574271827, rs1574302195, rs1574371399, rs1575603683, rs763339068, rs1588313568, rs1589416130, rs1592380672, rs1592148206, rs1592149793, rs1592149906, rs1592162415, rs1592162506, rs1596787821, rs1600755607, rs1600755429, rs1600731888, rs1601573302, rs1601566621, rs1601542702, rs1601542417, rs1600886270, rs1600766500, rs1574370981, rs1573962555, rs1574068971, rs1057524737, rs1574263047, rs1575601202, rs1554777464, rs1589393179, rs1597696047, rs1247507359, rs752927520, rs1473654961, rs1592380834, rs796053036, rs1573953706, rs1573973548, rs1573984110, rs1574007140, rs1574166948, rs745378416, rs1574209023, rs796053094, rs1574264920, rs1600714727, rs755159935, rs1574281711, rs779324355, rs1053767552, rs201894374, rs770456604, rs113094436, rs1578264574, rs1260191836, rs1578265048, rs1578265068, rs1578269200, rs1186496501, rs1578269761, rs756467468, rs1381665298, rs1578270476, rs1578274054, rs769243823, rs200059198, rs749975104, rs1578282133, rs1306655122, rs1600785769, rs1580990072, rs1584399108, rs1057519189, rs1595440453, rs1596872804, rs1597653264, rs1597676610, rs1599719527, rs1600755440, rs1600786071, rs770904422, rs1574525321, rs1840653547, rs749965674, rs1841611651, rs1841766225, rs1852152679, rs1853919580, rs1858669268, rs1941650264, rs1941714576, rs1938725748, rs2037920694, rs2037920791, rs2079949302, rs2079962041, rs2079972258, rs2080188103, rs2080189052, rs1057520773, rs2081071680, rs2081187047, rs2081187692, rs2081358991, rs2081378550, rs1698943949, rs1698602170, rs1698192456, rs1698176171, rs1369404945, rs1698003832, rs1698002491, rs1697999557, rs398123581, rs1697674296, rs1697473667, rs1697277384, rs1697160366, rs1697157422, rs1426666349, rs1697134047, rs1696883051, rs1696628056, rs794726823, rs1696403750, rs897883046, rs1696401617, rs1696356978, rs1696338792, rs1693176153, rs1692577292, rs1240187329, rs1553529527, rs1692166604, rs1691093633, rs1691039670, rs1690583220, rs1690345764, rs1690011364, rs1553521530, rs1553521051, rs1386425283, rs1573952473, rs1689300152, rs1689298888, rs1689285717, rs1689278461, rs1238612161, rs1689271621, rs1253117981, rs1689218857, rs1689211960, rs1689211569, rs1689200375, rs1689142827, rs1684673339, rs1684663586, rs1699367901, rs1553553462, rs1699149959, rs1698958802, rs746440689, rs1692586274, rs1697876590, rs727504142, rs1689985819, rs794726764, rs1704944478, rs1178244073, rs1840967817, rs2080693649, rs1938214529, rs2080696874, rs2081190512, rs1691073965, rs1689488709, rs1691048388, rs1692581621, rs1692870117, rs121918785, rs749539763, rs1842042825, rs2081190344, rs1600789325	23593274
Kidney disease	Kidney Diseases	rs74315342, rs749740335, rs757649673, rs112417755, rs35138315	19913069
Lung cancer	Malignant neoplasm of lung	rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135	12111688
Myeloperoxidase deficiency	Myeloperoxidase Deficiency, Myeloperoxidase deficiency	rs119468010, rs536522394, rs119469012, rs119469013, rs119469014, rs762933005	9354683, 15108282, 9766845, 8142659, 7904599, 9637725, 6260268, 8621627
Parkinson disease	Parkinsonian Disorders	rs33939927, rs35801418, rs34805604, rs35870237, rs34995376, rs74315355, rs28940284, rs74315356, rs74315357, rs28940285, rs730880302, rs750664040, rs74315359, rs74315360, rs45539432, rs119451946, rs80356771, rs74500255, rs75822236, rs1141814, rs78973108, rs121908681, rs121908686, rs121908687, rs137853054, rs137853055, rs137853056, rs137853057, rs137853058, rs137853059, rs34424986, rs137853060, rs397518439, rs28938172, rs74315351, rs74315353, rs137853051, rs118192098, rs121918104, rs1589451049, rs104893877, rs104893878, rs188286943, rs387906863, rs387906864, rs774631197, rs199935023, rs397514694, rs398122403, rs398122404, rs398122405, rs104886460, rs409652, rs431905511, rs63751392, rs756677845, rs864309527, rs864309650, rs750014782, rs1554391082, rs864622011, rs869312810, rs869312809, rs869312811, rs369100678, rs879253853, rs869320761, rs747506979, rs879255630, rs886039854, rs191486604, rs781442277, rs1060499619, rs751037529, rs55777503, rs768091663, rs34208370, rs1553122929, rs772786691, rs754809877, rs1555907463, rs1557561340, rs781600849, rs141263564, rs1557901552, rs777160388, rs756783990, rs867929413, rs1237637353, rs1005937012, rs755000580, rs747427602, rs1578089802, rs771586218, rs748142049, rs1582953433, rs746646126, rs771529549, rs121918106
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	21716162
Rheumatoid arthritis	Rheumatoid Arthritis	rs587776843	26001728, 22450443

Unknown
Disease term	Disease name	Evidence	References	Source
Mental depression	Major Depressive Disorder		20471444	ClinVar
Pancreatitis	Pancreatitis		16440434	ClinVar
Multiple Sclerosis	Multiple Sclerosis			GWAS
Oligodendroglioma	Oligodendroglioma			GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Acute Coronary Syndrome	Associate	11238037, 17512353, 26307104
Acute Generalized Exanthematous Pustulosis	Associate	32758448
Acute Kidney Injury	Associate	22739978
Acute On Chronic Liver Failure	Associate	34552111, 37816833
Adenoma	Associate	22126566
Aggressive Periodontitis	Associate	20364045
Alzheimer Disease	Associate	32171317, 37959001
Aneurysm Ruptured	Associate	34611229
Angina Unstable	Inhibit	12097534, 8606272
Angina Unstable	Stimulate	32481400
Angioedemas Hereditary	Associate	26654922
Anti Glomerular Basement Membrane Disease	Associate	28187981
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Associate	10691933, 11023517, 11737080, 12124874, 12371964, 20714105, 23577119, 24215168, 25060059, 26149790, 27752292, 28187981, 28939882, 31249574, 31471160, 31719529, 32446935, 32734361, 33408719, 33957974, 34289887, 35292437, 36428281, 37004177, 37331172, 39186910, 39287711, 39549483, 8565308
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Stimulate	29792176
Antiphospholipid Syndrome	Associate	25301710
Appendiceal Neoplasms	Associate	25666852
Arthritis	Associate	33139352
Arthritis Juvenile	Associate	34480465
Arthritis Psoriatic	Associate	32947961
Arthritis Rheumatoid	Associate	24928093, 27765067, 31430907, 33469455, 39456241
Ascites	Stimulate	39358478
Asthma	Associate	16385446, 19897513, 28659663
Asthma	Stimulate	23794464
Ataxia Telangiectasia	Associate	11549584
Atherosclerosis	Associate	11238037, 12861032, 16326702, 19625608, 20385548, 21235354, 21820048, 22219194, 24746542, 31307008, 33631301, 39456241, 9033274
Atrial Fibrillation	Associate	33460291, 37280612
Atrial Fibrillation	Stimulate	33460291
Atrophy	Associate	17451207, 18505072
Autoimmune Diseases	Associate	31719529, 33139352
Autoimmune enteropathy	Stimulate	32431271
Bacterial Infections	Associate	12393699
Behcet Syndrome	Associate	17855424
Bipolar Disorder	Stimulate	37147304
Blindness	Associate	17017121
Blindness	Inhibit	8394754
Blood Coagulation Disorders	Associate	39186910
Breast Neoplasms	Associate	18340529, 19752340, 23893381, 25703993, 26890638
Bronchiectasis	Associate	29733693
Capillary Leak Syndrome	Associate	31210423
Carcinoma Hepatocellular	Associate	34504150
Carcinoma Ovarian Epithelial	Associate	19962178, 23893381
Carcinoma Renal Cell	Associate	34528699
Carcinoma Squamous Cell	Associate	27197583, 29548309
Cardiovascular Diseases	Associate	12694338, 18719109, 19761988, 22219194, 24746542, 34639156, 39456241
Carotid Stenosis	Associate	29383971
Cerebral Hemorrhage	Associate	28969386
Cerebral Infarction	Associate	29041000
Cerebral Infarction	Stimulate	33378050
Cerebrovascular Disorders	Associate	33631301
Cholangitis Sclerosing	Associate	29180269
Chorioamnionitis	Associate	27318328
Chromosomal Instability	Associate	28969386
Chromosome Aberrations	Associate	20732340
Chromosome Breakage	Stimulate	26774631
Churg Strauss Syndrome	Stimulate	10456969
Colitis Ulcerative	Associate	20806430
Colitis Ulcerative	Stimulate	34183667
Colorectal Neoplasms	Associate	22126566, 40003985
Corneal Endothelial Cell Loss	Stimulate	28587670
Coronary Artery Disease	Associate	19761988, 23818485, 39456241
Coronary Disease	Inhibit	12097534
Coronary Disease	Associate	18514165, 36180886
COVID 19	Stimulate	32329756, 34276672, 35146763
COVID 19	Associate	34186206, 34916489, 35105380, 36482706, 37261353
Craniopharyngioma	Associate	40721446
Crohn Disease	Stimulate	34183667
Cystic Disease Of Lung	Associate	29937317
Cystic Fibrosis	Associate	16883063
Cystic Fibrosis	Stimulate	22178076, 24885494
Death	Associate	22949765
Demyelinating Autoimmune Diseases CNS	Associate	18042261
Demyelinating Diseases	Stimulate	18042261
Depressive Disorder Major	Associate	18514165
Diabetes Gestational	Associate	34530062
Diabetes Mellitus	Associate	12861032, 19527523, 216438, 23384293, 24746542, 25056433, 26360782
Diabetes Mellitus	Stimulate	20348234
Diabetes Mellitus Type 1	Associate	21900154
Diabetes Mellitus Type 1	Inhibit	35069582
Diabetes Mellitus Type 2	Associate	25056433, 29383971
Diabetic Angiopathies	Associate	29383971
Diabetic Nephropathies	Associate	15600254
Disease	Associate	9033274
DNA Virus Infections	Associate	27974636
Drug Hypersensitivity	Associate	1648980
Drug Related Side Effects and Adverse Reactions	Inhibit	11882038
Drug Related Side Effects and Adverse Reactions	Associate	24083736, 29244249
Duodenal Ulcer	Associate	15884126
Dysentery Bacillary	Stimulate	10816520
Dystonia 3 Torsion X Linked	Stimulate	32739252
Dystonia 3 Torsion X Linked	Associate	39500625
Ear Diseases	Stimulate	33664381
Emphysema	Associate	29138549
Environmental Illness	Stimulate	32431271
Erythema Ab Igne	Associate	14634123
Esophageal Neoplasms	Associate	37340770
Esophageal Squamous Cell Carcinoma	Associate	30539859
Fatty Liver Alcoholic	Associate	33169705
Fibrosis	Stimulate	33169705, 34504150
Fibrosis	Associate	9033274
Frontotemporal Dementia	Associate	36011324
Gastroesophageal Reflux	Stimulate	14688711
Gastrointestinal Diseases	Associate	17767014, 24083736, 9854050
Genetic Diseases Inborn	Stimulate	20732340
Glioblastoma	Associate	38174685
Glomerulonephritis	Associate	1848489, 29718465, 29792176, 7933836, 8698399
Glomerulonephritis IGA	Associate	31726998
Glomerulonephritis Membranous	Associate	29792176
Glycosuria Renal	Associate	33664381
Granulomatosis with Polyangiitis	Stimulate	10456969
Granulomatosis with Polyangiitis	Associate	11315931, 27656853, 31719529, 37334358
Granulomatous Disease Chronic	Associate	9854050
Hashimoto Disease	Associate	20714105
Heart Failure	Associate	39456241
Helicobacter Infections	Associate	15884126, 17767014, 18505072
HELLP Syndrome	Stimulate	23905607
Hemangioma	Associate	38206210
Hematologic Diseases	Associate	24083736
Hemolysis	Associate	29619129
Hepatitis Alcoholic	Stimulate	35490715
Hepatitis B	Associate	11167741, 34319037
Hereditary pancreatitis	Associate	33139352
Hip Injuries	Associate	34880852
Histiocytic Necrotizing Lymphadenitis	Associate	11549584
HIV Seropositivity	Associate	7731160, 9933467
Hypercalcemia	Stimulate	29548309
Hypertension	Associate	23384293, 25394640, 33460291
Hypothyroidism	Stimulate	31560937
Hypoxia	Stimulate	27581620, 28483502
Idiopathic Pulmonary Fibrosis	Associate	33076992
Immune Reconstitution Inflammatory Syndrome	Associate	29538651
Immunologic Deficiency Syndromes	Associate	20974672
Infarction	Associate	35080155
Infections	Associate	18505072
Infections	Stimulate	27048452, 36482706
Inflammation	Associate	15884126, 16126721, 16883063, 17451207, 17896805, 18205184, 18514165, 19527523, 19651670, 20031590, 20364045, 21235354, 21407237, 21658319, 23573303, 23734059, 24746542, 25120850, 26251029, 26307104, 27579896, 27928450, 27974636, 28969386, 29138549, 29619129, 30215671, 32154187, 32171317, 33176801, 33460291, 33547768, 33631301, 34552111, 34880852, 35880176, 35985771, 36064651, 36359815, 36809375, 37646165, 39456241, 9033274, 9854050
Inflammation	Stimulate	20806430, 39186910
Inflammatory Bowel Diseases	Associate	23573303
Intracranial Aneurysm	Associate	34611229
Intrahepatic Cholestasis of Pregnancy	Associate	24391750
Irritable Bowel Syndrome	Associate	25460734
Isodicentric Chromosome 15 Syndrome	Stimulate	19781775
Kidney Calculi	Associate	23874695
Kidney Diseases	Associate	15161651, 17896805, 22739978, 28187981
Kidney Failure Chronic	Associate	12694338
Kidney Failure Chronic	Inhibit	15600254
Labyrinth Diseases	Associate	26392121
Leiomyoma	Associate	28483502
Leukemia	Associate	1327288, 191121, 2410066, 24344295, 2553160, 26774631, 27974636, 29244249, 3022847, 3031662, 3048438, 35973983, 36930401, 3864499, 6329379, 7517211, 7795240, 9326240, 9662278, 9725460
Leukemia	Inhibit	19666867
Leukemia Biphenotypic Acute	Associate	21097707, 2166608, 8395912
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	191121
Leukemia Myeloid	Associate	1327288, 14716122, 18687517, 21097707, 21859636, 2790202, 3029127, 8395912, 9326240
Leukemia Myeloid Acute	Associate	10889907, 10910899, 11473459, 11835327, 12717686, 18256787, 1878594, 19255975, 19672946, 19781775, 22476996, 23325578, 24457336, 2553160, 3031662, 3036278, 3334895, 6329379, 7908235, 8380727, 8613429, 9002966, 9326240, 9662278, 9725460
Leukemia Myeloid Acute	Inhibit	19666867
Leukemia Myeloid Acute	Stimulate	28244454
Leukemia Promyelocytic Acute	Associate	1327288, 2410066, 3006833, 3031585, 32847610, 9326240
Leukemia T Cell	Associate	10889907, 11167741, 7795240, 8227405
Liver Cirrhosis	Associate	34504150
Lung Diseases	Associate	10456969, 16883063
Lung Diseases Interstitial	Associate	33076992, 33139352
Lung Injury	Associate	29212955
Lung Neoplasms	Associate	23979979, 24786234, 29970677
Lupus Erythematosus Systemic	Associate	11549584, 29588275, 30915077, 33176801, 35958624
Lupus Erythematosus Systemic	Inhibit	20201986
Lupus Erythematosus Systemic	Stimulate	37298160
Lupus Nephritis	Associate	17896805
Lupus Nephritis	Stimulate	37298160
Lymphoma Large B Cell Diffuse	Associate	31495056
Lymphoma Non Hodgkin	Associate	23795960
Lymphopenia	Associate	33317616
Malaria Cerebral	Associate	26884431
Metabolic Syndrome	Associate	25164947
Metaplasia	Stimulate	14688711
Microscopic Polyangiitis	Associate	11315931, 24385592
Mouth Diseases	Associate	12861032
Mucocutaneous Lymph Node Syndrome	Associate	26066543, 36510129
Mucolipidoses	Associate	30891029
Multiple Sclerosis	Inhibit	12810789
Multiple Sclerosis	Associate	18042261
Multiple Sclerosis Chronic Progressive	Inhibit	12810789
Myelodysplastic Syndromes	Associate	30334347, 31004030, 36207039, 36399441
Myeloperoxidase Deficiency	Associate	17017121, 3006833, 6189859, 8394754, 8621627, 9637725
Myeloperoxidase Deficiency	Inhibit	216438, 2462938, 2540860
Myocardial Infarction	Associate	17512353, 22949765, 33410147, 34387532, 35080155
Myocardial Infarction	Inhibit	8606272
Nasal Polyps	Associate	22178076, 32870597
Nasal Polyps	Inhibit	26849431
Nasopharyngeal Carcinoma	Associate	24340057
Necrosis	Associate	27765067
Neoplasm Residual	Associate	33048471
Neoplasms	Associate	10656748, 18296681, 24344295, 25797265, 26427914, 27197583, 27439439, 27531373, 29324871, 29331492, 3023307, 34971930, 35297370, 35855804, 36641653, 39456241, 39947398, 40430030, 9038763, 9364303
Neoplasms	Stimulate	14688711, 37935721
Neoplasms	Inhibit	16838325
Neoplastic Syndromes Hereditary	Inhibit	216438, 2540860
Nephrosclerosis	Associate	9033274
Neural Tube Defects	Associate	28397206
Neurodegenerative Diseases	Associate	25460734
Neuroinflammatory Diseases	Associate	39500625
Neutropenia Severe Congenital Autosomal Recessive 3	Associate	35525891
Neutrophil Immunodeficiency Syndrome	Associate	19729473
Non alcoholic Fatty Liver Disease	Stimulate	19729473
Obesity	Stimulate	19390527, 25388404, 25394640
Obesity	Associate	19729473, 24455214, 25703993
Odontogenic Cyst Calcifying	Associate	12861032
Osteoarthritis	Stimulate	22401873
Osteomyelitis	Associate	37085667
Ovarian Neoplasms	Associate	23893381, 27531373
Pancreatic Neoplasms	Associate	18205184
pediatric multisystem inflammatory disease COVID 19 related	Associate	36510129
Pelvic Inflammatory Disease	Stimulate	19147137
Peptic Ulcer	Associate	17451207
Peri Implantitis	Associate	32996143
Periodic fever familial autosomal dominant	Associate	29156107, 29588275, 31615411, 33149247, 33176801, 34449018, 35688556, 37857225
Peripheral Arterial Disease	Associate	19651670, 38172197
Peripheral Arterial Occlusive Disease 1	Associate	27991581
Personality Disorders	Associate	21795425, 23535901
Plaque Amyloid	Associate	16504169, 24781992
Plaque Atherosclerotic	Associate	11238037, 24464187, 38172197
Pneumonia	Associate	16883063
Polyarteritis Nodosa	Associate	8698399
Prader Willi Syndrome	Associate	37430349
Pre Eclampsia	Associate	25394640
Precancerous Conditions	Associate	19212761
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	2166608, 2458150, 29244249, 30313079, 3031662, 33048471, 34319037, 8395912, 9725460
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	11167741, 1977771, 2166608, 33161592, 9217186
Preeclamptic toxemia	Stimulate	25394640
Primary Myelofibrosis	Associate	33686952, 34238135
Prostatic Neoplasms	Associate	18296681, 21716162, 21795425, 23535901, 27706591
Prostatic Neoplasms Castration Resistant	Associate	26428930
Protein Energy Malnutrition	Associate	19129321
Psoriasis	Associate	32758448, 36011324
Pulmonary Disease Chronic Obstructive	Associate	22701684, 23794464, 32383462
Pulmonary Disease Chronic Obstructive	Stimulate	37935721
Purpura Thrombotic Thrombocytopenic	Associate	22611154
Pyoderma Gangrenosum	Stimulate	20636397, 21658319
Rectal Neoplasms	Associate	22531693
Renal Insufficiency	Associate	25935494
Renal Insufficiency	Stimulate	29548309
Renal Insufficiency Chronic	Associate	39826409
Respiration Disorders	Associate	19897513
Respiratory Distress Syndrome	Associate	25120850, 37261353
Respiratory Insufficiency	Associate	19897513
Respiratory Tract Diseases	Associate	19897513
Respiratory Tract Infections	Associate	16883063, 27928450
Retinal Dysplasia	Associate	18256787
Retinopathy of Prematurity	Inhibit	31266060
Rheumatoid Nodule	Associate	27765067
Rupture	Associate	34611229
Sarcoma Myeloid	Associate	27646584, 9038763
Schizophrenia	Associate	37147304
Schizophrenia	Inhibit	39940697
Sciatica	Associate	33535986, 33573686
Sepsis	Associate	29212955, 35681439, 37261353
Severe Acute Respiratory Syndrome	Associate	33634990, 37334358
Sjogren's Syndrome	Associate	33408719, 35854322
Skin Diseases	Associate	32758448, 34669971
Sleep Apnea Obstructive	Associate	33378050
Spinocerebellar Ataxia 11	Associate	29619129
Spondylitis Ankylosing	Associate	34880852
ST Elevation Myocardial Infarction	Associate	22949765, 35880176
Status Asthmaticus	Stimulate	27984639
Stomach Neoplasms	Associate	18505072, 29331492
Stomatitis	Inhibit	35563254
Stroke	Associate	21407237, 28969386
Stroke Lacunar	Associate	28969386
Superinfection	Associate	20974672
Sweet Syndrome	Associate	20636397, 27082547
Syndrome	Associate	36399441
Systemic Inflammatory Response Syndrome	Associate	26697531
Systemic Vasculitis	Associate	10792393, 12905492, 7933836, 8565308, 8698399, 9246211
Tay Sachs Disease	Associate	33139352
Thrombocythemia Essential	Associate	22059534
Thrombosis	Associate	25301710, 29894287, 37857225
Thrombosis	Stimulate	27928450, 33410147
Thrombotic Microangiopathies	Associate	22611154
Thyroid Cancer Papillary	Associate	34325712
Thyroid Neoplasms	Associate	37705974
Thyroiditis Autoimmune	Associate	9246211
Thyroiditis Suppurative	Associate	36853509
Ulcer	Stimulate	20636397
Urinary Bladder Neoplasms	Inhibit	24722645
Urinary Bladder Neoplasms	Associate	29267235, 34549902, 40430030
Uterine Cervical Neoplasms	Associate	17595772, 27197583
Varicocele	Associate	34975746
Vascular Diseases	Associate	15625114
Vascular System Injuries	Associate	24746542
Vasculitis	Associate	10691933, 1664417, 25060059, 27166610, 27752292, 28939882, 31790283, 32282021, 32734361, 33076992, 33664381, 37004177, 37331172, 37866310, 38056010, 39186910, 7579414, 8536374, 8698399, 9933467
Venous Thromboembolism	Stimulate	32781781
Venous Thromboembolism	Associate	34449018
Ventricular Dysfunction Left	Stimulate	33410147
Ventricular Remodeling	Associate	33410147
Virus Diseases	Associate	34276672
Weight Loss	Associate	37738560
WHIM syndrome	Associate	35525891