CD200 (CD200 molecule)

Gene

• Entrez ID: 4345
• Gene name: CD200 molecule
• Gene symbol: CD200
• Synonyms (NCBI Gene): MOX1, MOX2, MRC, OX-2
• Chromosome: 3
• Chromosome location: 3q13.2
• Summary: This gene encodes a type I membrane glycoprotein containing two extracellular immunoglobulin domains, a transmembrane and a cytoplasmic domain. This gene is expressed by various cell types, including B cells, a subset of T cells, thymocytes, endothelial c

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT669143	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT669142	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT669141	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT669140	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT669139	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT669138	hsa-miR-630	HITS-CLIP	23824327
MIRT669137	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT669136	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT669135	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT669134	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT669133	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT669132	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT669131	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT669130	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT669129	hsa-miR-6885-3p	HITS-CLIP	23824327
MIRT669128	hsa-miR-6830-3p	HITS-CLIP	23824327
MIRT659699	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT659698	hsa-miR-532-3p	HITS-CLIP	23824327
MIRT659697	hsa-miR-1260a	HITS-CLIP	23824327
MIRT659696	hsa-miR-1260b	HITS-CLIP	23824327
MIRT659695	hsa-miR-5691	HITS-CLIP	23824327
MIRT659694	hsa-miR-6805-3p	HITS-CLIP	23824327
MIRT659693	hsa-miR-511-5p	HITS-CLIP	23824327
MIRT669143	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT669142	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT669141	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT669140	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT669139	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT669138	hsa-miR-630	HITS-CLIP	23824327
MIRT669137	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT669136	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT669135	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT669134	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT669133	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT669132	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT669131	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT669130	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT669129	hsa-miR-6885-3p	HITS-CLIP	23824327
MIRT669128	hsa-miR-6830-3p	HITS-CLIP	23824327
MIRT659699	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT659698	hsa-miR-532-3p	HITS-CLIP	23824327
MIRT659697	hsa-miR-1260a	HITS-CLIP	23824327
MIRT659696	hsa-miR-1260b	HITS-CLIP	23824327
MIRT659695	hsa-miR-5691	HITS-CLIP	23824327
MIRT659694	hsa-miR-6805-3p	HITS-CLIP	23824327
MIRT659693	hsa-miR-511-5p	HITS-CLIP	23824327
MIRT2196221	hsa-miR-330-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002695	Process	Negative regulation of leukocyte activation	IEA
GO:0002695	Process	Negative regulation of leukocyte activation	TAS	12072366
GO:0005515	Function	Protein binding	IPI	21982860
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	3032785
GO:0008285	Process	Negative regulation of cell population proliferation	ISS
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IDA	11260322
GO:0009986	Component	Cell surface	IEA
GO:0009986	Component	Cell surface	ISS
GO:0009986	Component	Cell surface	TAS	9295026
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	12072366
GO:0030424	Component	Axon	IBA
GO:0030424	Component	Axon	IDA	19151626
GO:0032715	Process	Negative regulation of interleukin-6 production	ISS
GO:0034113	Process	Heterotypic cell-cell adhesion	IBA
GO:0034113	Process	Heterotypic cell-cell adhesion	IGI	11260322
GO:0034113	Process	Heterotypic cell-cell adhesion	ISS
GO:0043005	Component	Neuron projection	ISS
GO:0043025	Component	Neuronal cell body	IBA
GO:0043025	Component	Neuronal cell body	IDA	19151626
GO:0043025	Component	Neuronal cell body	ISS
GO:0043031	Process	Negative regulation of macrophage activation	IEA
GO:0043031	Process	Negative regulation of macrophage activation	ISS
GO:0043032	Process	Positive regulation of macrophage activation	IGI	26670206
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IDA	26670206
GO:0044297	Component	Cell body	IDA	19151626
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	26670206
GO:0050776	Process	Regulation of immune response	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	26670206
GO:0071346	Process	Cellular response to type II interferon	IDA	26670206
GO:0071636	Process	Positive regulation of transforming growth factor beta production	IGI	26670206
GO:0086080	Function	Protein binding involved in heterotypic cell-cell adhesion	ISS
GO:0098609	Process	Cell-cell adhesion	ISS
GO:0098632	Function	Cell-cell adhesion mediator activity	IBA
GO:0098632	Function	Cell-cell adhesion mediator activity	IEA
GO:0140081	Function	Glycosylated region protein binding	TAS	10981966
GO:0150077	Process	Regulation of neuroinflammatory response	ISS
GO:0150079	Process	Negative regulation of neuroinflammatory response	IBA
GO:0150079	Process	Negative regulation of neuroinflammatory response	ISS
GO:1904465	Process	Negative regulation of matrix metallopeptidase secretion	IDA	29101312
GO:1905522	Process	Negative regulation of macrophage migration	ISS
GO:2000405	Process	Negative regulation of T cell migration	ISS

Other IDs

• MIM: 155970
• HGNC: 7203
• e!Ensembl: ENSG00000091972

Protein

• UniProt ID: P41217
• Protein name: OX-2 membrane glycoprotein (CD antigen CD200)
• Protein function: Costimulates T-cell proliferation. May regulate myeloid cell activity in a variety of tissues.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00047	ig	35 → 136	Immunoglobulin domain	Domain
  PF00047	ig	143 → 229	Immunoglobulin domain	Domain

• Sequence:

  MERLVIRMPFSHLSTYSLVWVMAAVVLCTAQVQVVTQDEREQLYTPASLKCSLQNAQEAL
  IVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYM
  CLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIE
  NSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKGYWFSVPLL
  LSIVSLVILLVLISILLYWKRHRNQDRGELSQGVQKMT

• Sequence length: 278

Pathways

Reactome:

Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BASAL CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OTOSCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOIDOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Acute erythroleukemia	Stimulate	32212802	★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Associate	28429795	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Inhibit	18938162, 37801139	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Stimulate	23091555	★☆☆☆☆ Found in Text Mining only
Asthma	Associate	19187333, 24311777	★☆☆☆☆ Found in Text Mining only
Blast Injuries	Associate	29843224	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Associate	23940819, 24333170	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	17964286, 22791584, 29498809, 33932112, 37684436	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Associate	28821198	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Associate	36074574	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	32311840	★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Associate	28821198	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Associate	28821198	★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	32395395	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	18060403	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Stimulate	31363137	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Associate	23690219, 27035797	★☆☆☆☆ Found in Text Mining only
Cardiotoxicity	Inhibit	37684436	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Associate	38255930	★☆☆☆☆ Found in Text Mining only
Chronic Disease	Associate	18938162	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Stimulate	36601110	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Associate	37801139	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Stimulate	26690123	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Associate	28164626	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Associate	16571642, 28164626	★☆☆☆☆ Found in Text Mining only
Cytokine Release Syndrome	Associate	11967286	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Associate	37930093, 38603859	★☆☆☆☆ Found in Text Mining only
Desmoplastic Small Round Cell Tumor	Associate	32703985	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Associate	27577071	★☆☆☆☆ Found in Text Mining only
Focal cortical dysplasia of Taylor	Inhibit	27095555	★☆☆☆☆ Found in Text Mining only
Heart Failure	Associate	37684436	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Stimulate	23179394	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Associate	26584149, 28821198	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Associate	33606850	★☆☆☆☆ Found in Text Mining only
Hepatomegaly	Associate	30583344	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Associate	37227967	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Associate	23595568	★☆☆☆☆ Found in Text Mining only
Infections	Associate	36150362	★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	18938162, 22621248, 32395395	★☆☆☆☆ Found in Text Mining only
Inflammation	Inhibit	22334534, 32451434	★☆☆☆☆ Found in Text Mining only
Inflammation	Stimulate	38619621	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Associate	26690123, 28164626	★☆☆☆☆ Found in Text Mining only
Jejunal Neoplasms	Stimulate	18060403	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Associate	26910908	★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Associate	23632869, 23690219	★☆☆☆☆ Found in Text Mining only
Leukemia	Associate	21274000, 26137961, 26338961, 27718302, 30583344, 33147339	★☆☆☆☆ Found in Text Mining only
Leukemia B Cell	Associate	22899296, 35661398, 37822353	★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Associate	24243815, 24903677, 31077558, 37822353	★☆☆☆☆ Found in Text Mining only
Leukemia Lymphocytic Chronic B Cell	Stimulate	16418292, 24243815, 26910908, 36748379	★☆☆☆☆ Found in Text Mining only
Leukemia Lymphocytic Chronic B Cell	Associate	18060403, 22180482, 22547582, 27111430, 28109040, 28713070, 28984300, 29220870, 30328261, 30583344, 31443741, 32716606, 33606850, 34061467, 37378922	★☆☆☆☆ Found in Text Mining only
Leukemia Lymphoid	Associate	30583344	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Associate	21274000, 23179394, 26338961, 26584149, 29720577, 29843224, 32212802, 32856848, 33054128, 33147339, 33596632	★☆☆☆☆ Found in Text Mining only
Leukemia Prolymphocytic T Cell	Associate	28832948, 37822353	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Associate	22621248	★☆☆☆☆ Found in Text Mining only
Lymphoma	Associate	22180482, 24243815	★☆☆☆☆ Found in Text Mining only
Lymphoma B Cell	Associate	22899296, 24243815, 32716606, 37227967	★☆☆☆☆ Found in Text Mining only
Lymphoma B Cell Marginal Zone	Associate	29220870	★☆☆☆☆ Found in Text Mining only
Lymphoma Mantle Cell	Associate	22180482, 24352646, 28713070, 28984300, 29220870, 31054894, 37822353	★☆☆☆☆ Found in Text Mining only
Lymphoma Mantle Cell	Inhibit	24243815	★☆☆☆☆ Found in Text Mining only
Lymphoma T Cell	Associate	35661398	★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	18008004, 18060403	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Associate	22498111	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Associate	16946299, 22180482, 26287276, 26763359, 27877018	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Stimulate	25529228	★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Associate	35661398	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Associate	32856848, 40049088	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	18060403	★☆☆☆☆ Found in Text Mining only
Neoplasm Residual	Associate	26287276	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	17964286, 18060403, 21274000, 22180482, 23632869, 23690219, 27035797, 27462861, 28429795, 28821198, 30132130, 32166404, 32395395, 36074574, 38619621	★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	32514618	★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	38619621	★☆☆☆☆ Found in Text Mining only
Neoplasms Squamous Cell	Associate	35661398	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Stimulate	32514618	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Associate	18938162	★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Associate	28821198	★☆☆☆☆ Found in Text Mining only
Neuroinflammatory Diseases	Associate	37801139	★☆☆☆☆ Found in Text Mining only
Osteoarthropathy Primary Hypertrophic	Associate	23595568	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	18060403	★☆☆☆☆ Found in Text Mining only
Pain	Associate	23595568	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	28821198, 30132130, 38619621	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Associate	38619621	★☆☆☆☆ Found in Text Mining only
Pancreatoblastoma	Associate	30132130	★☆☆☆☆ Found in Text Mining only
Pre Eclampsia	Associate	36484353	★☆☆☆☆ Found in Text Mining only
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	27718302, 29161980	★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	26137961, 29161980	★☆☆☆☆ Found in Text Mining only
Pyruvate Carboxylase Deficiency Disease	Associate	36752202	★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Associate	35661398	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Associate	26584149, 28821198	★☆☆☆☆ Found in Text Mining only
Splenomegaly	Associate	29161980, 30583344	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	30242969	★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Associate	29161980	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Inhibit	27095555	★☆☆☆☆ Found in Text Mining only