Gene Gene information from NCBI Gene database.
Entrez ID 4340
Gene name Myelin oligodendrocyte glycoprotein
Gene symbol MOG
Synonyms (NCBI Gene)
BTN6BTNL11MOGIG2NRCLP7
Chromosome 6
Chromosome location 6p22.1
Summary The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may
SNPs SNP information provided by dbSNP.
1
SNP ID Visualize variation Clinical significance Consequence
rs387906655 C>G Pathogenic Missense variant, coding sequence variant, intron variant
miRNA miRNA information provided by mirtarbase database.
180
miRTarBase ID miRNA Experiments Reference
MIRT684185 hsa-miR-6890-3p HITS-CLIP 23313552
MIRT684184 hsa-miR-6736-3p HITS-CLIP 23313552
MIRT684183 hsa-miR-660-3p HITS-CLIP 23313552
MIRT684182 hsa-miR-939-3p HITS-CLIP 23313552
MIRT684181 hsa-miR-6852-5p HITS-CLIP 23313552
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12
GO ID Ontology Definition Evidence Reference
GO:0001618 Function Virus receptor activity IEA
GO:0001817 Process Regulation of cytokine production IBA
GO:0005102 Function Signaling receptor binding IBA
GO:0005515 Function Protein binding IPI 32296183, 32814053
GO:0005886 Component Plasma membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
159465 7197 ENSG00000204655
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q16653
Protein name Myelin-oligodendrocyte glycoprotein
Protein function Mediates homophilic cell-cell adhesion (By similarity). Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell-cell communication. ; (Microbial infection) A
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 36 145 Immunoglobulin V-set domain Domain
Tissue specificity TISSUE SPECIFICITY: Found exclusively in the CNS, where it is localized on the surface of myelin and oligodendrocyte cytoplasmic membranes.
Sequence
MASLSRPSLPSCLCSFLLLLLLQVSSSYAGQFRVIGPRHPIRALVGDEVELPCRISPGKN
ATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFS
DEGGFTCFFRDHSYQEEAAMELKVE
DPFYWVSPGVLVLLAVLPVLLLQITVGLIFLCLQY
RLRGKLRAEIENLHRTFDPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFL
EELRNPF
Sequence length 247
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
7
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Narcolepsy 7 Pathogenic rs387906655 RCV000022667
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
MOG-related disorder Benign; Likely benign rs2857766, rs370604035, rs3130253, rs537236203, rs34758289 RCV003974343
RCV003903889
RCV003984491
RCV003937297
RCV003979023
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 24586351
Aphasia Conduction Associate 34725263
Bipolar Disorder Associate 25539505
Celiac Disease Associate 31554915
Communicable Diseases Associate 35990698
Demyelinating Autoimmune Diseases CNS Associate 30825703
Demyelinating Diseases Stimulate 29288492, 37370056
Demyelinating Diseases Associate 29468668, 32430437, 34725263
Encephalitis Associate 35990698
Encephalomyelitis Associate 30847372