Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4340
Gene name Gene Name - the full gene name approved by the HGNC.
Myelin oligodendrocyte glycoprotein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MOG
Synonyms (NCBI Gene) Gene synonyms aliases
BTN6, BTNL11, MOGIG2, NRCLP7
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p22.1
Summary Summary of gene provided in NCBI Entrez Gene.
The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs387906655 C>G Pathogenic Missense variant, coding sequence variant, intron variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT684185 hsa-miR-6890-3p HITS-CLIP 23313552
MIRT684184 hsa-miR-6736-3p HITS-CLIP 23313552
MIRT684183 hsa-miR-660-3p HITS-CLIP 23313552
MIRT684182 hsa-miR-939-3p HITS-CLIP 23313552
MIRT684181 hsa-miR-6852-5p HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001618 Function Virus receptor activity IEA
GO:0001817 Process Regulation of cytokine production IBA
GO:0005102 Function Signaling receptor binding IBA
GO:0005515 Function Protein binding IPI 32296183, 32814053
GO:0005886 Component Plasma membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
159465 7197 ENSG00000204655
Protein
UniProt ID Q16653
Protein name Myelin-oligodendrocyte glycoprotein
Protein function Mediates homophilic cell-cell adhesion (By similarity). Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell-cell communication. ; (Microbial infection) A
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 36 145 Immunoglobulin V-set domain Domain
Tissue specificity TISSUE SPECIFICITY: Found exclusively in the CNS, where it is localized on the surface of myelin and oligodendrocyte cytoplasmic membranes.
Sequence
MASLSRPSLPSCLCSFLLLLLLQVSSSYAGQFRVIGPRHPIRALVGDEVELPCRISPGKN
ATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFS
DEGGFTCFFRDHSYQEEAAMELKVE
DPFYWVSPGVLVLLAVLPVLLLQITVGLIFLCLQY
RLRGKLRAEIENLHRTFDPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFL
EELRNPF
Sequence length 247
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Narcolepsy narcolepsy 7 rs387906655 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Cervical Cancer Cervical cancer N/A N/A GWAS
Dental caries Dental caries N/A N/A GWAS
Inflammatory Bowel Disease Inflammatory bowel disease N/A N/A GWAS
Insomnia Insomnia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 24586351
Aphasia Conduction Associate 34725263
Bipolar Disorder Associate 25539505
Celiac Disease Associate 31554915
Communicable Diseases Associate 35990698
Demyelinating Autoimmune Diseases CNS Associate 30825703
Demyelinating Diseases Stimulate 29288492, 37370056
Demyelinating Diseases Associate 29468668, 32430437, 34725263
Encephalitis Associate 35990698
Encephalomyelitis Associate 30847372