MOBP (myelin associated oligodendrocyte basic protein)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 4336
Gene name Myelin associated oligodendrocyte basic protein
Gene symbol MOBP
Synonyms (NCBI Gene)
-
Chromosome 3
Chromosome location 3p22.1
miRNA miRNA information provided by mirtarbase database.
350
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (350)
miRTarBase ID miRNA Experiments Reference
MIRT022298 hsa-miR-124-3p Microarray 18668037
MIRT023529 hsa-miR-1-3p Microarray 18668037
MIRT606948 hsa-miR-8485 HITS-CLIP 22927820
MIRT607605 hsa-miR-329-3p HITS-CLIP 22927820
MIRT607604 hsa-miR-362-3p HITS-CLIP 22927820
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (6)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 26871637, 32296183
GO:0005737 Component Cytoplasm IEA
GO:0005739 Component Mitochondrion IEA
GO:0007399 Process Nervous system development TAS 7989345
GO:0019911 Function Structural constituent of myelin sheath IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
600948 7189 ENSG00000168314
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q13875
Protein name Myelin-associated oligodendrocyte basic protein
Protein function May play a role in compacting or stabilizing the myelin sheath, possibly by binding the negatively charged acidic phospholipids of the cytoplasmic membrane.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02318 FYVE_2 3 → 78 FYVE-type zinc finger Family
Sequence 
MSQKPAKEGPRLSKNQKYSEHFSIHCCPPFTFLNSKKEIVDRKYSICKSGCFYQKKEEDW
ICCACQKTRTSRRAKSPQRPKQQPAAPPAVVRAPAKPRSPPRSERQPRSPPRSERQPRSP
PRSERQPRSPPRSERQPRPRPEVRPPPAKQRPPQKSKQQPRSSPLRGPGASRGGSPVKAS
RFW
Sequence length 183
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
7
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (2)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Amyotrophic lateral sclerosis Uncertain significance rs1188260744 RCV001260205
MOBP-related disorder Likely benign; Uncertain significance rs995835006, rs755066817, rs768845645, rs781467178, rs185064368, rs1559424420 RCV003429047
RCV003392795
RCV003397593
RCV003421024
RCV003981488
RCV003969019
Show/Hide Text Mining Associations (20)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer's disease without Neurofibrillary tangles Associate 27115769
Amyotrophic Lateral Sclerosis Associate 27455348, 34946282, 37979250
Arthritis Rheumatoid Associate 24994843
Autism Spectrum Disorder Associate 32954437
Cognition Disorders Associate 34474300
Corticobasal Degeneration Associate 26077951, 28271184
Focal cortical dysplasia of Taylor Associate 34301297
Frontotemporal Dementia Associate 24994843, 37979250
Frontotemporal Lobar Degeneration Associate 24373676, 34474300
Glioblastoma Associate 34516348