Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4336
Gene name Gene Name - the full gene name approved by the HGNC.
Myelin associated oligodendrocyte basic protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MOBP
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3p22.1
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022298 hsa-miR-124-3p Microarray 18668037
MIRT023529 hsa-miR-1-3p Microarray 18668037
MIRT606948 hsa-miR-8485 HITS-CLIP 22927820
MIRT607605 hsa-miR-329-3p HITS-CLIP 22927820
MIRT607604 hsa-miR-362-3p HITS-CLIP 22927820
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003779 Function Actin binding IBA 21873635
GO:0005515 Function Protein binding IPI 25416956, 26871637
GO:0005739 Component Mitochondrion IEA
GO:0007399 Process Nervous system development TAS 7989345
GO:0017022 Function Myosin binding IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600948 7189 ENSG00000168314
Protein
UniProt ID Q13875
Protein name Myelin-associated oligodendrocyte basic protein
Protein function May play a role in compacting or stabilizing the myelin sheath, possibly by binding the negatively charged acidic phospholipids of the cytoplasmic membrane.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02318 FYVE_2 3 78 FYVE-type zinc finger Family
Sequence
MSQKPAKEGPRLSKNQKYSEHFSIHCCPPFTFLNSKKEIVDRKYSICKSGCFYQKKEEDW
ICCACQKTRTSRRAKSPQ
RPKQQPAAPPAVVRAPAKPRSPPRSERQPRSPPRSERQPRSP
PRSERQPRSPPRSERQPRPRPEVRPPPAKQRPPQKSKQQPRSSPLRGPGASRGGSPVKAS
RFW
Sequence length 183
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Alzheimer disease Alzheimer`s Disease rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039
View all (65 more)
23535033
Amyotrophic lateral sclerosis Amyotrophic Lateral Sclerosis, Amyotrophic Lateral Sclerosis, Guam Form, AMYOTROPHIC LATERAL SCLEROSIS 6 (disorder), AMYOTROPHIC LATERAL SCLEROSIS 1, AUTOSOMAL RECESSIVE rs267607084, rs312262720, rs312262752, rs121908287, rs121908288, rs29001584, rs28941475, rs121434378, rs386134173, rs386134174, rs80356730, rs80356727, rs4884357, rs80356717, rs80356733
View all (171 more)
27455348, 28931804
Attention deficit hyperactivity disorder Attention deficit hyperactivity disorder rs786205019 18839057
Lateral sclerosis AMYOTROPHIC LATERAL SCLEROSIS 1, Amyotrophic Lateral Sclerosis, Sporadic rs386134181, rs386134176, rs386134174, rs386134184, rs386134178, rs1693780539, rs1574698048 28931804
Unknown
Disease term Disease name Evidence References Source
Amyotrophic Lateral Sclerosis Amyotrophic Lateral Sclerosis GWAS
Corticobasal Degeneration Corticobasal Degeneration GWAS
Attention Deficit Hyperactivity Disorder Attention Deficit Hyperactivity Disorder GWAS
Progressive Supranuclear Palsy Progressive Supranuclear Palsy GWAS
Associations from Text Mining
Disease Name Relationship Type References
Alzheimer's disease without Neurofibrillary tangles Associate 27115769
Amyotrophic Lateral Sclerosis Associate 27455348, 34946282, 37979250
Arthritis Rheumatoid Associate 24994843
Autism Spectrum Disorder Associate 32954437
Cognition Disorders Associate 34474300
Corticobasal Degeneration Associate 26077951, 28271184
Focal cortical dysplasia of Taylor Associate 34301297
Frontotemporal Dementia Associate 24994843, 37979250
Frontotemporal Lobar Degeneration Associate 24373676, 34474300
Glioblastoma Associate 34516348