Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4322
Gene name	Matrix metallopeptidase 13
Gene symbol	MMP13
Synonyms (NCBI Gene)	CLG3MANDP1MDSTMMP-13
Chromosome	11
Chromosome location	11q22.2
Summary	This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and t

Show/Hide all (12)

SNP ID	Visualize variation	Clinical significance	Consequence
rs17860530	G>A	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant
rs121909497	A>G	Pathogenic	Coding sequence variant, missense variant
rs121909498	A>G	Pathogenic	Coding sequence variant, missense variant
rs121909499	A>G	Pathogenic	Coding sequence variant, missense variant
rs121909500	G>T	Pathogenic	Coding sequence variant, missense variant
rs140059558	A>C,G	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs150203792	C>T	Conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant
rs369083541	G>A	Pathogenic	Stop gained, coding sequence variant
rs374419716	A>T	Conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs797044754	->C	Pathogenic	Frameshift variant, coding sequence variant
rs1057518391	T>G	Likely-pathogenic	Splice acceptor variant
rs1565256477	A>G	Pathogenic	Coding sequence variant, missense variant

Show/Hide all (25)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000737	hsa-miR-199a-5p	Review	19574400
MIRT000734	hsa-miR-145-5p	Review	19574400
MIRT000025	hsa-miR-9-5p	Luciferase reporter assay	19008124
MIRT003427	hsa-miR-27b-3p	ELISALuciferase reporter assayqRT-PCRWestern blot	20131257
MIRT003420	hsa-miR-100-5p	MicroarrayqRT-PCRWestern blot	19396866
MIRT003961	hsa-miR-140-5p	Microarray	17875710
MIRT003961	hsa-miR-140-5p	qRT-PCR	19948051
MIRT006557	hsa-miR-27a-3p	qRT-PCR	19948051
MIRT006990	hsa-miR-125b-5p	Luciferase reporter assay	22782903
MIRT006990	hsa-miR-125b-5p	Luciferase reporter assay	22782903
MIRT021540	hsa-miR-143-3p	Western blot;Microarray	21427707
MIRT021796	hsa-miR-132-3p	Microarray	17612493
MIRT053120	hsa-miR-127-3p	Luciferase reporter assay	23762330
MIRT021540	hsa-miR-143-3p	Luciferase reporter assay	23732700
MIRT734854	hsa-miR-675-5p	Luciferase reporter assayWestern blottingRNA-seq	33513878
MIRT736692	hsa-miR-579-3p	Luciferase reporter assayWestern blottingqRT-PCRFlow cytometry	33408506
MIRT756472	hsa-miR-182-5p	qRT-PCR	38796528
MIRT1153163	hsa-miR-204	CLIP-seq
MIRT1153164	hsa-miR-211	CLIP-seq
MIRT1153165	hsa-miR-3168	CLIP-seq
MIRT1153166	hsa-miR-340	CLIP-seq
MIRT1153167	hsa-miR-4755-5p	CLIP-seq
MIRT1153168	hsa-miR-4780	CLIP-seq
MIRT1153169	hsa-miR-513a-3p	CLIP-seq
MIRT1153170	hsa-miR-623	CLIP-seq

Show/Hide all (13)

Transcription factor	Regulation	Reference
CITED2	Repression	12960175
ESR1	Unknown	19185056
ETS1	Activation	22270366
HDAC4	Repression	17656568;19423655
HDAC9	Activation	18054336
ING2	Activation	19437536
JUN	Activation	20338993
MAF	Activation	20067416
NFKB1	Activation	12734180;19022820
RELA	Activation	12734180;19022820
RUNX2	Activation	15564063
STAT1	Repression	17179173
YBX1	Repression	17822788

Show/Hide all (37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001958	Process	Endochondral ossification	IEA
GO:0003417	Process	Growth plate cartilage development	IEA
GO:0004175	Function	Endopeptidase activity	IDA	18164633
GO:0004175	Function	Endopeptidase activity	IEA
GO:0004222	Function	Metalloendopeptidase activity	IBA
GO:0004222	Function	Metalloendopeptidase activity	IDA	8576151, 9065415
GO:0004222	Function	Metalloendopeptidase activity	IEA
GO:0004222	Function	Metalloendopeptidase activity	TAS	8609233
GO:0004252	Function	Serine-type endopeptidase activity	TAS
GO:0005509	Function	Calcium ion binding	IDA	23913860
GO:0005518	Function	Collagen binding	IDA	9065415
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	TAS	8207000
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	TAS	8207000
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008270	Function	Zinc ion binding	IDA	23913860
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	TAS	8207000
GO:0016787	Function	Hydrolase activity	IEA
GO:0022617	Process	Extracellular matrix disassembly	IEA
GO:0022617	Process	Extracellular matrix disassembly	IMP	8576151, 9065415
GO:0022617	Process	Extracellular matrix disassembly	TAS
GO:0030198	Process	Extracellular matrix organization	IBA
GO:0030282	Process	Bone mineralization	IEA
GO:0030574	Process	Collagen catabolic process	IBA
GO:0030574	Process	Collagen catabolic process	IDA	8576151, 9065415
GO:0030574	Process	Collagen catabolic process	IEA
GO:0030574	Process	Collagen catabolic process	IEA
GO:0030574	Process	Collagen catabolic process	TAS
GO:0031012	Component	Extracellular matrix	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0060349	Process	Bone morphogenesis	IDA	16167086
GO:1904645	Process	Response to amyloid-beta	TAS	28912710

MIM	HGNC	e!Ensembl
600108	7159	ENSG00000137745

P45452

Protein name

Collagenase 3 (EC 3.4.24.-) (Matrix metalloproteinase-13) (MMP-13)

Protein function

Plays a role in the degradation of extracellular matrix proteins including fibrillar collagen, fibronectin, TNC and ACAN. Cleaves triple helical collagens, including type I, type II and type III collagen, but has the highest activity with solubl

PDB

1EUB , 1FLS , 1FM1 , 1PEX , 1XUC , 1XUD , 1XUR , 1YOU , 1ZTQ , 2D1N , 2E2D , 2OW9 , 2OZR , 2PJT , 2YIG , 3ELM , 3I7G , 3I7I , 3KEC , 3KEJ , 3KEK , 3KRY , 3LJZ , 3O2X , 3TVC , 3WV1 , 3WV2 , 3WV3 , 3ZXH , 456C , 4A7B , 4FU4 , 4FVL , 4G0D , 4JP4 , 4JPA , 4L19 , 5B5O , 5B5P , 5BOT , 5BOY , 5BPA , 5UWK , 5UWL , 5UWM , 5UWN , 7JU8 , 830C

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01471	PG_binding_1	32 → 91	Putative peptidoglycan binding domain	Domain
PF00413	Peptidase_M10	112 → 267	Matrixin	Domain
PF00045	Hemopexin	290 → 332	Hemopexin	Repeat
PF00045	Hemopexin	334 → 377	Hemopexin	Repeat
PF00045	Hemopexin	382 → 429	Hemopexin	Repeat
PF00045	Hemopexin	431 → 471	Hemopexin	Repeat

Tissue specificity

TISSUE SPECIFICITY: Detected in fetal cartilage and calvaria, in chondrocytes of hypertrophic cartilage in vertebrae and in the dorsal end of ribs undergoing ossification, as well as in osteoblasts and periosteal cells below the inner periosteal region of

Sequence

MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENA
ASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTY
RIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDG
PSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALM
FPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGET
MIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGY
DILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLI
EEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC

Sequence length

471

Interactions

View interactions

	KEGG		Reactome
	IL-17 signaling pathway Relaxin signaling pathway Parathyroid hormone synthesis, secretion and action		Collagen degradation Degradation of the extracellular matrix Activation of Matrix Metalloproteinases Assembly of collagen fibrils and other multimeric structures RUNX2 regulates genes involved in cell migration

165

Show/Hide Causal Diseases (5)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Lung cancer	Likely pathogenic	rs368922836	RCV005925409
Metaphyseal anadysplasia 1, autosomal dominant	Likely pathogenic; Pathogenic	rs748468302, rs140059558, rs121909498, rs121909499	RCV002271832 RCV004019951 RCV000010051 RCV000010052
Metaphyseal chondrodysplasia, Spahr type	Likely pathogenic; Pathogenic	rs140059558, rs369083541, rs121909499, rs121909500	RCV000162347 RCV000162348 RCV004795389 RCV000010053
MMP13-related disorder	Likely pathogenic; Pathogenic	rs797044754	RCV004528951
Spondyloepimetaphyseal dysplasia, Missouri type	Likely pathogenic; Pathogenic	rs2496470105, rs369083541, rs121909497, rs121909499, rs1565256477, rs1301955422	RCV002306431 RCV005394566 RCV000010050 RCV004597726 RCV000757993 RCV001293681

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Cervical cancer	Benign	rs17860556	RCV005891931
Intellectual disability	Conflicting classifications of pathogenicity	rs781966264	RCV005626560
Malignant lymphoma, large B-cell, diffuse	Benign	rs17860556	RCV005891932
Metaphyseal anadysplasia	Conflicting classifications of pathogenicity; Benign; Uncertain significance; Likely benign	rs17860530, rs1042840, rs886047552, rs886047555, rs781825443, rs17860568, rs200537937, rs886047550, rs35477433, rs886047556, rs145425594, rs185832993, rs142601143, rs782723542, rs886047551 View all (38 more)	RCV001105674 RCV000305964 RCV000321253 RCV000387291 RCV000397357 RCV000326758 RCV000394257 RCV000349456 RCV000364412 RCV000288782 RCV000406196 RCV000334477 RCV000273496 RCV000373260 RCV000398225 RCV000262290 RCV000372044 RCV000332656 RCV000347361 RCV000397360 RCV000260906 RCV000381273 RCV000338592 RCV000368048 RCV000380643 RCV000377094 RCV000334378 RCV000300878 RCV000370540 RCV000331254 RCV000298241 RCV000365430 RCV000322504 RCV000278733 RCV000402601 RCV000362352 RCV001103628 RCV001106505 RCV001106508 RCV001108692 RCV001108695 RCV001103533 RCV001106616 RCV001106617 RCV001106619 RCV001106715 RCV001108882 RCV001108884 RCV001103725 RCV001103726 RCV001106799 RCV001108779 RCV001108780
Spondyloepimetaphyseal dysplasia	Uncertain significance; Benign	rs886047552, rs35477433, rs886047556	RCV000266222 RCV000390277 RCV000343744
Thymoma	Benign	rs17860556	RCV005891933

Show/Hide Text Mining Associations (190)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Achalasia Addisonianism Alacrimia syndrome	Associate	22710868
Achondrogenesis type 2	Associate	31277141, 36939200
Adenocarcinoma	Associate	24563279
Adenocarcinoma of Lung	Stimulate	27227769
Adenocarcinoma of Lung	Associate	37000142
Adenoma	Associate	24563279
Adenomatous Polyps	Associate	24563279
Adrenal Hyperplasia Congenital	Associate	24380766
Alzheimer Disease	Associate	33892965
Aneurysm	Associate	18971037, 23913860, 26918470
Anodontia	Associate	16868967, 24351915
Anterior Cruciate Ligament Injuries	Stimulate	26762166
Anterior Cruciate Ligament Injuries	Associate	37919719
Aortic Aneurysm Abdominal	Associate	14522424
Arterial Occlusive Diseases	Associate	14522424
Arthritis	Associate	12355484, 12734180, 12814616, 17822788, 19248099, 23913860, 24385683, 27052781, 30440036
Arthritis	Stimulate	22102411
Arthritis Infectious	Associate	20740673
Arthritis Psoriatic	Associate	18647851, 22102411, 9665469
Arthritis Psoriatic	Stimulate	20740673
Arthritis Rheumatoid	Associate	10403281, 10531073, 10753945, 11040455, 11959761, 16242974, 16891219, 17255320, 19883500, 27498552, 27534557, 30046030, 30058700, 32867828, 34195267 View all (4 more)
Arthritis Rheumatoid	Stimulate	35955467
Asthma	Associate	37259023
Atherosclerosis	Associate	11805151, 23913860
Atypical Squamous Cells of the Cervix	Inhibit	31108390
Bloom Syndrome	Associate	40016774
Brain Neoplasms	Associate	34452576
Breast Diseases	Associate	34452576
Breast Neoplasms	Associate	12459458, 16849519, 18373849, 19243594, 19531263, 19661326, 21344163, 23317273, 25510449, 31292488, 33031905, 34452576, 34643237, 36190948, 8207000, 8609233, 9665469 View all (2 more)
Bursitis	Stimulate	30667085, 32270543
Bursitis	Associate	30667085, 36008780
Calcinosis Cutis	Associate	31587013
Carcinogenesis	Associate	25401159, 27245877, 37000142, 9242512
Carcinoma	Stimulate	37108089
Carcinoma Basal Cell	Associate	24398989, 34171070, 9242512
Carcinoma Ductal	Associate	34452576
Carcinoma Hepatocellular	Associate	19140237, 26378022, 39513468
Carcinoma Non Small Cell Lung	Associate	30889876
Carcinoma Pancreatic Ductal	Associate	28475017
Carcinoma Squamous Cell	Associate	25556475
Cardiomyopathy Dilated	Associate	16095497
Cardiomyopathy Hypertrophic	Associate	22796508, 26174816
Cartilage Diseases	Associate	10765924, 11212179, 12734180, 16891219, 17968949, 19248099, 19784544, 22102411, 22469853, 24385683, 25263345, 26045200, 26395178, 26762166, 26931159 View all (9 more)
Cholesteatoma	Associate	22714856
Chondrosarcoma	Associate	15736455, 16549373, 21278254, 9531484, 9665469
Chorioamnionitis	Associate	11741975
Chromosome Aberrations	Associate	24781753
Chronic Pain	Associate	20857147
Chronic Periodontitis	Associate	27058373
Colitis Ulcerative	Associate	21477272
Collagen Diseases	Associate	30440036, 34270864
Collagenopathy type 2 alpha 1	Associate	8609233
Colonic Neoplasms	Associate	39738398
Colorectal Neoplasms	Associate	17876296, 18054336, 19437536, 24563279, 28944862, 35104263, 39513468
Constriction Pathologic	Associate	22710868
Corneal Diseases	Associate	28631887
Corneal Injuries	Associate	31022731
Coronary Artery Disease	Associate	22710868
Coxa Magna	Associate	39253583
Crohn Disease	Associate	15804950, 39738398
Cytokine Release Syndrome	Stimulate	11352241, 23473976
Dental Caries	Associate	32398053
Desmoid disease hereditary	Associate	15054469
Developmental Dysplasia of the Hip	Associate	28185391
Diabetes Mellitus Type 1	Associate	25607396
Diabetic Retinopathy	Associate	36745438
Diverticular Diseases	Stimulate	24681094
Dupuytren Contracture	Associate	17336841, 24293067
Epiphyseal dysplasia multiple 1	Associate	12355484, 29247272
Esophageal Neoplasms	Associate	27245877, 27356690
Esophageal Squamous Cell Carcinoma	Associate	21689625, 24610617, 27245877, 27356690, 27779648, 37609436
Esophageal Squamous Cell Carcinoma	Stimulate	37774793
Fetal Membranes Premature Rupture	Associate	11741975
Fibrocartilaginous embolism	Associate	30468453
Fibromatosis Gingival	Inhibit	28937892
Fibrosis	Stimulate	31022731
Gallbladder Neoplasms	Associate	21039987
Genetic Diseases Inborn	Associate	16167086
Gingival Overgrowth	Associate	28937892
Gingivitis	Associate	28937892
Glioblastoma	Associate	24599080, 25835975
Glucagonoma	Associate	26362844
Glut1 Deficiency Syndrome	Associate	34967278
Granuloma	Associate	19720222
Granulosa cell tumor of the ovary	Associate	19442604
Growth Disorders	Associate	24781753
Head and Neck Neoplasms	Associate	32736506
HEM dysplasia	Associate	16167086
Hemorrhage	Associate	37203300
Hidradenitis Suppurativa	Associate	33965402
Hypertrophy	Associate	25279550, 26123554, 31409892, 33485931, 34143208
Hypoxia	Stimulate	17099219, 19661326, 28349784, 30468453, 31587013
Hypoxia	Inhibit	23965235
Hypoxia Brain	Stimulate	19661326, 23965235, 28349784, 31746371
Hypoxia Brain	Associate	34073090
Immunologic Deficiency Syndromes	Associate	16167086
Infections	Associate	15664960
Infections	Stimulate	31470617
Inflammation	Associate	12847684, 14522424, 21854562, 24283517, 24563279, 26215036, 27956552, 29095837, 30440036, 31053727, 31110047, 32271403, 32736506, 32948212, 34679084 View all (5 more)
Inflammation	Stimulate	17311929, 20857147, 22102411, 23473976, 26337479
Intervertebral Disc Degeneration	Associate	33038032, 33677096, 37329158
Intervertebral disc disease	Associate	26279428, 33677096, 40016774
Intracranial Aneurysm	Associate	26918470
Iridogoniodysgenesis and skeletal anomalies	Associate	16167086
Kashin Beck Disease	Associate	25263345
Keratoacanthoma	Associate	16699496
Keratoconus	Associate	22413749
Laryngotracheal Stenosis Progressive with Short Stature and Arthropathy	Associate	28349784
Leiomyoma	Associate	23814095
Leukoplakia	Associate	29699065
Lumbar Stenosis Familial	Stimulate	35904178
Lung Diseases Interstitial	Stimulate	33446609
Lung Neoplasms	Associate	19094243, 25149157, 30889876
Lymphatic Metastasis	Stimulate	10861264
Lymphatic Metastasis	Associate	19140237, 23317273, 24610617, 25401159
Melanoma	Associate	10360651, 20667128, 24963846, 38527983
Melanoma	Stimulate	16398406
Melanoma Cutaneous Malignant	Associate	16398406
Mesothelioma Malignant	Associate	19815709
Metaphyseal anadysplasia	Associate	24781753
Metaphyseal chondrodysplasia Spahr type	Associate	31413057
Mitochondrial Diseases	Associate	20338993
Mitochondrial Diseases	Stimulate	33097606
Mitral Valve Prolapse Myxomatous 1	Associate	34258920
Mouth Neoplasms	Associate	18225566
Multiple Myeloma	Associate	24870599
Musculoskeletal Diseases	Associate	23417678
Nasopharyngeal Carcinoma	Associate	26362844
Nasopharyngeal Neoplasms	Stimulate	26362844
Neointima	Associate	20827277
Neoplasm Metastasis	Associate	17342087, 22270366, 24610617, 24870599, 25085584, 25835975, 26369384, 26378022, 30003735, 30941969, 31587013, 34452576, 38527983
Neoplasm Metastasis	Stimulate	26362844
Neoplasms	Associate	10027405, 10861264, 11487270, 15291964, 16398406, 16465195, 17822788, 18225566, 18373849, 18507821, 20160732, 20338993, 21948155, 23913860, 24398989 View all (18 more)
Neoplasms	Stimulate	31200666, 31996191, 37000142
Nerve Degeneration	Associate	10753945
Nerve Sheath Neoplasms	Associate	17786186
Neurodegenerative Diseases	Associate	33677096
Neurofibrosarcoma	Associate	15255999, 17786186
Niemann Pick Disease Type C	Associate	33038032
Obesity	Associate	20534145
Oculocerebrorenal Syndrome	Inhibit	16868967
Oral Submucous Fibrosis	Associate	29699065
Osteoarthritis	Associate	10643716, 10765924, 11212179, 12882354, 14558091, 14629961, 14697681, 15498796, 15743480, 15922185, 16806998, 18164633, 18802112, 19784544, 19948051 View all (63 more)
Osteoarthritis	Stimulate	14730609, 19333945, 26123554, 29728632, 33300061, 35955467, 36463522, 37108698, 39342381
Osteoarthritis Knee	Associate	30635366, 32409720, 33903094, 34992344
Osteomyelitis	Associate	19821768
Osteoporosis	Inhibit	21452281
Osteosarcoma	Associate	26104765
Ovarian Neoplasms	Associate	12743421, 22270366, 31587013
Pain	Associate	35023382, 35409262
Peri Implantitis	Associate	27058373
Periodontal Diseases	Associate	15664960
Periodontitis	Associate	25037760, 25607396
Plaque Atherosclerotic	Associate	11342575, 22710868
Polyposis Syndrome Hereditary Mixed 1	Associate	24563279
Precancerous Conditions	Associate	27716617
Preterm Premature Rupture of the Membranes	Associate	11741975
Prostatic Intraepithelial Neoplasia	Stimulate	31090157
Prostatic Neoplasms	Associate	15467730, 19610059, 31090157
Prostatitis	Associate	20160732
Pterygium	Associate	28068383
Retinal Dysplasia	Associate	27716617
Root Resorption	Associate	39596178
Sarcoma Kaposi	Associate	25234715
Scleral Diseases	Associate	19002264
Sialadenitis	Associate	15901067
Sick Sinus Syndrome	Associate	18373849
Spinal Stenosis	Associate	19885059
Spondyloepimetaphyseal Dysplasia Missouri Type	Associate	16167086
Spondyloepimetaphyseal Dysplasia X Linked	Associate	16167086
Squamous Cell Carcinoma of Head and Neck	Associate	10027405, 15291964, 16097450, 21205837, 25401159, 29345283, 29699065, 31109699, 31304688, 31815689, 31996191, 37443802, 9250162
Status Asthmaticus	Stimulate	14968124
Stomach Neoplasms	Associate	25085584, 30003735, 30941969
Stomach Neoplasms	Stimulate	28128735
Stomatitis	Associate	25218607
Synovitis	Associate	16891219
Temporomandibular Joint Disorders	Stimulate	33145347
Tertiary Lymphoid Structures	Stimulate	27356690
Thyroid Neoplasms	Associate	20492683
Tooth Resorption	Associate	17853491
Tricuspid Valve Stenosis	Stimulate	17382648
Urethral Neoplasms	Associate	27448299
Urinary Bladder Neoplasms	Associate	24008762, 26369384, 26517808
Uterine Cervical Neoplasms	Associate	10027405, 15989693
Uveal melanoma	Stimulate	34587931
Varicose Ulcer	Associate	27460704
Varicose Veins	Stimulate	18971037
Vitamin K Deficiency	Associate	34992344
Vulvar Diseases	Associate	10027405
Wounds and Injuries	Associate	40170451

MMP13 (matrix metallopeptidase 13)