MMP11 (matrix metallopeptidase 11)

Gene

• Entrez ID: 4320
• Gene name: Matrix metallopeptidase 11
• Gene symbol: MMP11
• Synonyms (NCBI Gene): SL-3, ST3, STMY3
• Chromosome: 22
• Chromosome location: 22q11.23
• Summary: Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as art

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006905	hsa-miR-125a-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	22768249
MIRT732735	hsa-miR-139-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	27355528
MIRT732735	hsa-miR-139-3p	Immunohistochemistry (IHC), Luciferase reporter assay, qRT-PCR, Western blotting	31595150
MIRT756084	hsa-miR-202-3p	Luciferase reporter assay, Western blotting, qRT-PCR	37226011
MIRT1153150	hsa-miR-1251	CLIP-seq
MIRT1153151	hsa-miR-193a-5p	CLIP-seq
MIRT1153152	hsa-miR-1976	CLIP-seq
MIRT1153153	hsa-miR-3185	CLIP-seq
MIRT1153154	hsa-miR-3187-3p	CLIP-seq
MIRT1153155	hsa-miR-4293	CLIP-seq
MIRT1153156	hsa-miR-4426	CLIP-seq
MIRT1153157	hsa-miR-4529-5p	CLIP-seq
MIRT1153158	hsa-miR-4647	CLIP-seq
MIRT1153159	hsa-miR-4662b	CLIP-seq
MIRT1153160	hsa-miR-596	CLIP-seq
MIRT1153161	hsa-miR-615-5p	CLIP-seq
MIRT1153162	hsa-miR-661	CLIP-seq
MIRT2390960	hsa-miR-4251	CLIP-seq
MIRT2390961	hsa-miR-4329	CLIP-seq
MIRT2390962	hsa-miR-622	CLIP-seq
MIRT2571974	hsa-miR-125b	CLIP-seq
MIRT2571975	hsa-miR-3616-3p	CLIP-seq
MIRT2571976	hsa-miR-4319	CLIP-seq
MIRT2571977	hsa-miR-4721	CLIP-seq
MIRT2571978	hsa-miR-4761-3p	CLIP-seq
MIRT2571979	hsa-miR-544b	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
SP1	Activation	22227581

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004222	Function	Metalloendopeptidase activity	IBA
GO:0004222	Function	Metalloendopeptidase activity	IEA
GO:0004222	Function	Metalloendopeptidase activity	TAS	7746327
GO:0004252	Function	Serine-type endopeptidase activity	TAS
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005796	Component	Golgi lumen	TAS
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	TAS	1701851
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0022617	Process	Extracellular matrix disassembly	TAS
GO:0030198	Process	Extracellular matrix organization	IBA
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0030199	Process	Collagen fibril organization	IEA
GO:0030574	Process	Collagen catabolic process	IBA
GO:0030574	Process	Collagen catabolic process	IEA
GO:0030574	Process	Collagen catabolic process	IEA
GO:0030574	Process	Collagen catabolic process	TAS
GO:0031012	Component	Extracellular matrix	IDA	18622425
GO:0031012	Component	Extracellular matrix	IEA
GO:0031012	Component	Extracellular matrix	TAS	1701851
GO:0045599	Process	Negative regulation of fat cell differentiation	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0071711	Process	Basement membrane organization	IEA

Other IDs

• MIM: 185261
• HGNC: 7157
• e!Ensembl: ENSG00000099953

Protein

• UniProt ID: P24347
• Protein name: Stromelysin-3 (SL-3) (ST3) (EC 3.4.24.-) (Matrix metalloproteinase-11) (MMP-11)
• Protein function: May play an important role in the progression of epithelial malignancies.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00413	Peptidase_M10	104 → 258	Matrixin	Domain
  PF00045	Hemopexin	298 → 341	Hemopexin	Repeat
  PF00045	Hemopexin	343 → 383	Hemopexin	Repeat
  PF00045	Hemopexin	387 → 434	Hemopexin	Repeat
  PF00045	Hemopexin	436 → 480	Hemopexin	Repeat

• Tissue specificity: TISSUE SPECIFICITY: Specifically expressed in stromal cells of breast carcinomas.
• Sequence:

  MAPAAWLRSAAARALLPPMLLLLLQPPPLLARALPPDAHHLHAERRGPQPWHAALPSSPA
  PAPATQEAPRPASSLRPPRCGVPDPSDGLSARNRQKRFVLSGGRWEKTDLTYRILRFPWQ
  LVQEQVRQTMAEALKVWSDVTPLTFTEVHEGRADIMIDFARYWHGDDLPFDGPGGILAHA
  FFPKTHREGDVHFDYDETWTIGDDQGTDLLQVAAHEFGHVLGLQHTTAAKALMSAFYTFR
  YPLSLSPDDCRGVQHLYGQPWPTVTSRTPALGPQAGIDTNEIAPLEPDAPPDACEASFDA
  VSTIRGELFFFKAGFVWRLRGGQLQPGYPALASRHWQGLPSPVDAAFEDAQGHIWFFQGA
  QYWVYDGEKPVLGPAPLTELGLVRFPVHAALVWGPEKNKIYFFRGRDYWRFHPSTRRVDS
  PVPRRATDWRGVPSEIDAAFQDADGYAYFLRGRLYWKFDPVKVKALEGFPRLVGPDFFGC
  AEPANTFL

• Sequence length: 488

Pathways

Reactome:

Collagen degradation
Degradation of the extracellular matrix
Activation of Matrix Metalloproteinases