Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4314
Gene name Gene Name - the full gene name approved by the HGNC.	Matrix metallopeptidase 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MMP3
Synonyms (NCBI Gene) Gene synonyms aliases	CHDS6, MMP-3, SL-1, STMY, STMY1, STR1
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q22.2
Summary Summary of gene provided in NCBI Entrez Gene.	Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as art

Show/Hide all(17)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021683	hsa-miR-138-5p	qRT-PCR	21770894
MIRT734092	hsa-miR-18a-3p	Luciferase reporter assay, qRT-PCR, Western blotting	33392094
MIRT735402	hsa-miR-31-5p	Luciferase reporter assay, Western blotting, qRT-PCR, ELISA	31934214
MIRT2572209	hsa-miR-1231	CLIP-seq
MIRT2572210	hsa-miR-1267	CLIP-seq
MIRT2572211	hsa-miR-2115	CLIP-seq
MIRT2572212	hsa-miR-3127-3p	CLIP-seq
MIRT2572213	hsa-miR-3614-5p	CLIP-seq
MIRT2572214	hsa-miR-3618	CLIP-seq
MIRT2572215	hsa-miR-4288	CLIP-seq
MIRT2572216	hsa-miR-4477a	CLIP-seq
MIRT2572217	hsa-miR-4672	CLIP-seq
MIRT2572218	hsa-miR-4684-3p	CLIP-seq
MIRT2572219	hsa-miR-4704-3p	CLIP-seq
MIRT2572220	hsa-miR-516a-3p	CLIP-seq
MIRT2572221	hsa-miR-520f	CLIP-seq
MIRT2572222	hsa-miR-632	CLIP-seq

Transcription factors

Show/Hide all(11)

Transcription factor	Regulation	Reference
ETS1	Unknown	10358095;10949659;11556732;12034715
ETS2	Unknown	10358095
FOS	Unknown	9334186
JUN	Activation	1429874;15777790
JUN	Unknown	9334186
NFKB1	Unknown	11376631
NFKBIA	Unknown	11376631
RELA	Unknown	11376631
SOX2	Activation	22184093
STAT3	Unknown	17460772;23967200
ZNF148	Activation	15003528

Show/Hide all(45)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0004175	Function	Endopeptidase activity	IDA	15863497, 19022250, 20969476
GO:0004175	Function	Endopeptidase activity	IEA
GO:0004222	Function	Metalloendopeptidase activity	IBA
GO:0004222	Function	Metalloendopeptidase activity	IEA
GO:0004222	Function	Metalloendopeptidase activity	TAS	3360803
GO:0004252	Function	Serine-type endopeptidase activity	TAS
GO:0005515	Function	Protein binding	IPI	9573338, 20969476, 25416956
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	TAS	3360803
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IEA
GO:0006508	Process	Proteolysis	IDA	12867428, 15863497, 19022250, 20969476
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	TAS	3360803
GO:0008233	Function	Peptidase activity	IDA	23845380
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IDA	9573338
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0022617	Process	Extracellular matrix disassembly	TAS
GO:0030163	Process	Protein catabolic process	IEA
GO:0030198	Process	Extracellular matrix organization	IBA
GO:0030334	Process	Regulation of cell migration	IEA
GO:0030574	Process	Collagen catabolic process	IBA
GO:0030574	Process	Collagen catabolic process	IEA
GO:0030574	Process	Collagen catabolic process	TAS
GO:0031012	Component	Extracellular matrix	IEA
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IDA	19022250
GO:0034614	Process	Cellular response to reactive oxygen species	IEA
GO:0034614	Process	Cellular response to reactive oxygen species	ISS
GO:0045087	Process	Innate immune response	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	TAS	25049354
GO:0071230	Process	Cellular response to amino acid stimulus	IEA
GO:0071492	Process	Cellular response to UV-A	IDA	31380578
GO:0071732	Process	Cellular response to nitric oxide	TAS	15863497
GO:0150077	Process	Regulation of neuroinflammatory response	TAS	25049354
GO:1904645	Process	Response to amyloid-beta	TAS	28912710
GO:2000378	Process	Negative regulation of reactive oxygen species metabolic process	IDA	20969476

MIM	HGNC	e!Ensembl
185250	7173	ENSG00000149968

Protein

UniProt ID

P08254

Protein name

Stromelysin-1 (SL-1) (EC 3.4.24.17) (Matrix metalloproteinase-3) (MMP-3) (Transin-1)

Protein function

Metalloproteinase with a rather broad substrate specificity that can degrade fibronectin, laminin, gelatins of type I, III, IV, and V; collagens III, IV, X, and IX, and cartilage proteoglycans. Activates different molecules including growth fact

PDB

1B3D , 1B8Y , 1BIW , 1BM6 , 1BQO , 1C3I , 1C8T , 1CAQ , 1CIZ , 1CQR , 1D5J , 1D7X , 1D8F , 1D8M , 1G05 , 1G49 , 1G4K , 1HFS , 1HY7 , 1OO9 , 1QIA , 1QIC , 1SLM , 1SLN , 1UEA , 1UMS , 1UMT , 1USN , 2D1O , 2JNP , 2JT5 , 2JT6 , 2SRT , 2USN , 3OHL , 3OHO , 3USN , 4DPE , 4G9L , 4JA1 , 6MAV , 6N9D , 7S7L , 7S7M

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01471	PG_binding_1	27 → 87	Putative peptidoglycan binding domain	Domain
PF00413	Peptidase_M10	108 → 264	Matrixin	Domain
PF00045	Hemopexin	296 → 338	Hemopexin	Repeat
PF00045	Hemopexin	340 → 383	Hemopexin	Repeat
PF00045	Hemopexin	388 → 435	Hemopexin	Repeat
PF00045	Hemopexin	437 → 477	Hemopexin	Repeat

Sequence

MKSLPILLLLCVAVCSAYPLDGAARGEDTSMNLVQKYLENYYDLKKDVKQFVRRKDSGPV
VKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYRIVN
YTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNV
LAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLY
HSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVS
TLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQF
WAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEP
GFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC

Sequence length

477

Interactions

View interactions

	KEGG		Reactome
	IL-17 signaling pathway TNF signaling pathway Coronavirus disease - COVID-19 Transcriptional misregulation in cancer Prostate cancer Rheumatoid arthritis Lipid and atherosclerosis		Collagen degradation Degradation of the extracellular matrix Activation of Matrix Metalloproteinases Assembly of collagen fibrils and other multimeric structures EGFR Transactivation by Gastrin Interleukin-4 and Interleukin-13 signaling Extra-nuclear estrogen signaling

MMP3 (matrix metallopeptidase 3)