Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4313
Gene name	Matrix metallopeptidase 2
Gene symbol	MMP2
Synonyms (NCBI Gene)	CLG4CLG4AMMP-2MMP-IIMONATBE-1
Chromosome	16
Chromosome location	16q12.2
Summary	This gene is a member of the matrix metalloproteinase (MMP) gene family, that are zinc-dependent enzymes capable of cleaving components of the extracellular matrix and molecules involved in signal transduction. The protein encoded by this gene is a gelati

Show/Hide all (10)

SNP ID	Visualize variation	Clinical significance	Consequence
rs41459945	G>A,C	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs121912953	G>A	Pathogenic	Coding sequence variant, missense variant
rs121912954	C>A,G	Pathogenic	Coding sequence variant, stop gained
rs121912955	G>A	Pathogenic	Coding sequence variant, missense variant
rs140172728	G>A	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Synonymous variant, coding sequence variant
rs148801200	C>A,T	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant, synonymous variant
rs786205497	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs794727275	C>-	Pathogenic	Coding sequence variant, frameshift variant
rs794727916	G>-	Pathogenic	Coding sequence variant, frameshift variant
rs1567378779	C>-	Pathogenic	Frameshift variant, coding sequence variant

685

Show/Hide all (685)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005570	hsa-miR-29b-3p	Luciferase reporter assayqRT-PCRWestern blot	20657750
MIRT005570	hsa-miR-29b-3p	Luciferase reporter assayqRT-PCRWestern blot	20657750
MIRT005742	hsa-miR-451a	qRT-PCRWestern blot	20816946
MIRT005570	hsa-miR-29b-3p	Western blot	23254643
MIRT018099	hsa-miR-335-5p	Microarray	18185580
MIRT019228	hsa-miR-338-3p	Western blot;qRT-PCR	21671467
MIRT030716	hsa-miR-21-5p	qRT-PCR	19435867
MIRT031370	hsa-miR-17-5p	Western blot	20209605
MIRT005570	hsa-miR-29b-3p	Western blot	24130681
MIRT053245	hsa-miR-29c-3p	qRT-PCRWestern blot	23175151
MIRT053336	hsa-miR-491-5p	ImmunohistochemistryMicroarrayqRT-PCRWestern blot	23725476
MIRT053481	hsa-miR-9-5p	qRT-PCR	21931274
MIRT053580	hsa-miR-29a-3p	ImmunofluorescenceImmunohistochemistryLuciferase reporter assayNorthern blotqRT-PCRWestern blot	24130168
MIRT053580	hsa-miR-29a-3p	ImmunofluorescenceImmunohistochemistryLuciferase reporter assayNorthern blotqRT-PCRWestern blot	24130168
MIRT005570	hsa-miR-29b-3p	ImmunofluorescenceImmunohistochemistryLuciferase reporter assayNorthern blotqRT-PCRWestern blot	24130168
MIRT005570	hsa-miR-29b-3p	ImmunofluorescenceImmunohistochemistryLuciferase reporter assayNorthern blotqRT-PCRWestern blot	24130168
MIRT053245	hsa-miR-29c-3p	ImmunofluorescenceImmunohistochemistryLuciferase reporter assayNorthern blotqRT-PCRWestern blot	24130168
MIRT053245	hsa-miR-29c-3p	ImmunofluorescenceImmunohistochemistryLuciferase reporter assayNorthern blotqRT-PCRWestern blot	24130168
MIRT005570	hsa-miR-29b-3p	Microarray	22942087
MIRT053787	hsa-miR-452-5p	MicroarrayqRT-PCR	22952876
MIRT437388	hsa-miR-708-5p	FlowqRT-PCRWestern blot	23754151
MIRT053580	hsa-miR-29a-3p	Luciferase reporter assay	22745231
MIRT005570	hsa-miR-29b-3p	Luciferase reporter assay	22745231
MIRT053245	hsa-miR-29c-3p	Luciferase reporter assay	22745231
MIRT437572	hsa-miR-767-5p	Luciferase reporter assay	22745231
MIRT005570	hsa-miR-29b-3p	Luciferase reporter assayqRT-PCR	23354167
MIRT005570	hsa-miR-29b-3p	Western blot	24147037
MIRT438234	hsa-miR-221-3p	Western blot	24147037
MIRT438153	hsa-miR-106b-5p	Luciferase reporter assay	24164962
MIRT438153	hsa-miR-106b-5p	Luciferase reporter assay	24164962
MIRT438153	hsa-miR-106b-5p	Luciferase reporter assay	24164962
MIRT438153	hsa-miR-106b-5p	Luciferase reporter assay	24164962
MIRT053245	hsa-miR-29c-3p	Luciferase reporter assayqRT-PCRWestern blot	23936390
MIRT005570	hsa-miR-29b-3p	Luciferase reporter assayqRT-PCR	23354167
MIRT005570	hsa-miR-29b-3p	Western blot	24147037
MIRT438234	hsa-miR-221-3p	Western blot	24147037
MIRT438153	hsa-miR-106b-5p	Luciferase reporter assay	24164962
MIRT438153	hsa-miR-106b-5p	Luciferase reporter assay	24164962
MIRT438153	hsa-miR-106b-5p	Luciferase reporter assay	24164962
MIRT438153	hsa-miR-106b-5p	Luciferase reporter assay	24164962
MIRT053245	hsa-miR-29c-3p	Luciferase reporter assayqRT-PCRWestern blot	23936390
MIRT724938	hsa-miR-4691-5p	HITS-CLIP	19536157
MIRT724937	hsa-miR-6792-3p	HITS-CLIP	19536157
MIRT724936	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT724935	hsa-miR-29b-2-5p	HITS-CLIP	19536157
MIRT724934	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT724933	hsa-miR-1238-3p	HITS-CLIP	19536157
MIRT440222	hsa-miR-544a	HITS-CLIP	24374217
MIRT440222	hsa-miR-544a	HITS-CLIP	24374217
MIRT731061	hsa-miR-130b-3p	qRT-PCRLuciferase reporter assayWestern blot	25154741
MIRT731061	hsa-miR-130b-3p	qRT-PCRLuciferase reporter assayWestern blot	25154741
MIRT731453	hsa-miR-125b-5p	Luciferase reporter assay	27133077
MIRT731453	hsa-miR-125b-5p	Luciferase reporter assay	27133077
MIRT053580	hsa-miR-29a-3p	Luciferase reporter assay	26700017
MIRT005742	hsa-miR-451a	qRT-PCRWestern blot	27173190
MIRT005570	hsa-miR-29b-3p	Luciferase reporter assayqRT-PCRWestern blot	26063204
MIRT005570	hsa-miR-29b-3p	Luciferase reporter assayqRT-PCRWestern blot	26063204
MIRT005570	hsa-miR-29b-3p	Luciferase reporter assayqRT-PCRWestern blot	26063204
MIRT005570	hsa-miR-29b-3p	Luciferase reporter assayqRT-PCRWestern blot	26063204
MIRT005570	hsa-miR-29b-3p	Luciferase reporter assayqRT-PCRWestern blot	26063204
MIRT005570	hsa-miR-29b-3p	Luciferase reporter assayqRT-PCRWestern blot	26063204
MIRT005570	hsa-miR-29b-3p	Luciferase reporter assayqRT-PCRWestern blot	26063204
MIRT005570	hsa-miR-29b-3p	Luciferase reporter assayqRT-PCRWestern blot	26063204
MIRT005570	hsa-miR-29b-3p	Luciferase reporter assayqRT-PCRWestern blot	26063204
MIRT005570	hsa-miR-29b-3p	Luciferase reporter assayqRT-PCRWestern blot	26063204
MIRT005570	hsa-miR-29b-3p	Luciferase reporter assayqRT-PCRWestern blot	26063204
MIRT732484	hsa-miR-20a-3p	Luciferase reporter assayqRT-PCRWestern blotting	33788053
MIRT732713	hsa-miR-34a-5p	qRT-PCR	33773546
MIRT732990	hsa-miR-1237-3p	Microarray	33435900
MIRT438153	hsa-miR-106b-5p	Luciferase reporter assayqRT-PCR	32699607
MIRT019228	hsa-miR-338-3p	Luciferase reporter assayWestern blottingqRT-PCRFlow cytometry	33817311
MIRT732484	hsa-miR-20a-3p	Western blottingImmunoprecipitaion (IP)qRT-PCR	33788053
MIRT737478	hsa-miR-200a-3p	Luciferase reporter assayWestern blottingqRT-PCR	31772330
MIRT724938	hsa-miR-4691-5p	HITS-CLIP	19536157
MIRT724937	hsa-miR-6792-3p	HITS-CLIP	19536157
MIRT724936	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT724935	hsa-miR-29b-2-5p	HITS-CLIP	19536157
MIRT724934	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT724933	hsa-miR-1238-3p	HITS-CLIP	19536157
MIRT755535	hsa-miR-149-5p	qRT-PCR	36250208
MIRT755915	hsa-miR-145-5p	Luciferase reporter assayWestern blottingqRT-PCR	35722425
MIRT756341	hsa-miR-518a-5p	Western blottingqRT-PCR	37132750
MIRT756431	hsa-miR-146a-5p	qRT-PCR	36415628
MIRT756466	hsa-miR-182-5p	qRT-PCR	38796528
MIRT1153360	hsa-miR-1324	CLIP-seq
MIRT1153361	hsa-miR-3164	CLIP-seq
MIRT1153362	hsa-miR-3944-5p	CLIP-seq
MIRT1153363	hsa-miR-617	CLIP-seq
MIRT1153364	hsa-miR-296-3p	CLIP-seq
MIRT1153365	hsa-miR-3921	CLIP-seq
MIRT1153366	hsa-miR-4443	CLIP-seq
MIRT1153367	hsa-miR-4649-3p	CLIP-seq
MIRT1153368	hsa-miR-4653-5p	CLIP-seq
MIRT1153369	hsa-miR-4654	CLIP-seq
MIRT1153370	hsa-miR-4769-5p	CLIP-seq
MIRT1153371	hsa-miR-541	CLIP-seq
MIRT1153372	hsa-miR-654-5p	CLIP-seq
MIRT1551365	hsa-miR-330-3p	CLIP-seq
MIRT1551366	hsa-miR-4685-5p	CLIP-seq
MIRT1551367	hsa-miR-520g	CLIP-seq
MIRT1551368	hsa-miR-520h	CLIP-seq
MIRT2043917	hsa-miR-765	CLIP-seq
MIRT2273303	hsa-miR-29a	CLIP-seq
MIRT2273304	hsa-miR-29b	CLIP-seq
MIRT2273305	hsa-miR-29c	CLIP-seq
MIRT2273306	hsa-miR-3065-3p	CLIP-seq
MIRT1551365	hsa-miR-330-3p	CLIP-seq
MIRT2273307	hsa-miR-4436b-3p	CLIP-seq
MIRT1551366	hsa-miR-4685-5p	CLIP-seq
MIRT2273308	hsa-miR-4690-3p	CLIP-seq
MIRT2273309	hsa-miR-4733-3p	CLIP-seq
MIRT2431185	hsa-miR-106a	CLIP-seq
MIRT2431186	hsa-miR-106b	CLIP-seq
MIRT2431187	hsa-miR-124	CLIP-seq
MIRT2431188	hsa-miR-17	CLIP-seq
MIRT2431189	hsa-miR-20a	CLIP-seq
MIRT2431190	hsa-miR-20b	CLIP-seq
MIRT2431191	hsa-miR-2110	CLIP-seq
MIRT1153364	hsa-miR-296-3p	CLIP-seq
MIRT2431192	hsa-miR-3179	CLIP-seq
MIRT2431193	hsa-miR-3202	CLIP-seq
MIRT1551365	hsa-miR-330-3p	CLIP-seq
MIRT2431194	hsa-miR-3616-5p	CLIP-seq
MIRT2431195	hsa-miR-3647-5p	CLIP-seq
MIRT2431196	hsa-miR-3688-5p	CLIP-seq
MIRT2431197	hsa-miR-3714	CLIP-seq
MIRT2431198	hsa-miR-3910	CLIP-seq
MIRT2431199	hsa-miR-4263	CLIP-seq
MIRT2431200	hsa-miR-4271	CLIP-seq
MIRT2431201	hsa-miR-4293	CLIP-seq
MIRT1153366	hsa-miR-4443	CLIP-seq
MIRT2431202	hsa-miR-4519	CLIP-seq
MIRT2431203	hsa-miR-4521	CLIP-seq
MIRT2431204	hsa-miR-4530	CLIP-seq
MIRT1153369	hsa-miR-4654	CLIP-seq
MIRT2431205	hsa-miR-4716-3p	CLIP-seq
MIRT2431206	hsa-miR-4725-3p	CLIP-seq
MIRT2431207	hsa-miR-4747-5p	CLIP-seq
MIRT1153370	hsa-miR-4769-5p	CLIP-seq
MIRT2431208	hsa-miR-4790-3p	CLIP-seq
MIRT2431209	hsa-miR-4795-5p	CLIP-seq
MIRT2431210	hsa-miR-506	CLIP-seq
MIRT2431211	hsa-miR-519a	CLIP-seq
MIRT2431212	hsa-miR-519b-3p	CLIP-seq
MIRT2431213	hsa-miR-519c-3p	CLIP-seq
MIRT2431214	hsa-miR-519d	CLIP-seq
MIRT2431215	hsa-miR-520d-5p	CLIP-seq
MIRT1551367	hsa-miR-520g	CLIP-seq
MIRT1551368	hsa-miR-520h	CLIP-seq
MIRT1153371	hsa-miR-541	CLIP-seq
MIRT2431216	hsa-miR-563	CLIP-seq
MIRT2431217	hsa-miR-573	CLIP-seq
MIRT2431218	hsa-miR-595	CLIP-seq
MIRT2431219	hsa-miR-625	CLIP-seq
MIRT2431220	hsa-miR-644	CLIP-seq
MIRT1153372	hsa-miR-654-5p	CLIP-seq
MIRT2431221	hsa-miR-885-3p	CLIP-seq
MIRT2431222	hsa-miR-93	CLIP-seq
MIRT2438718	hsa-miR-1207-5p	CLIP-seq
MIRT2438719	hsa-miR-1238	CLIP-seq
MIRT2438720	hsa-miR-1253	CLIP-seq
MIRT2438721	hsa-miR-1273f	CLIP-seq
MIRT2438722	hsa-miR-1321	CLIP-seq
MIRT1153360	hsa-miR-1324	CLIP-seq
MIRT2438723	hsa-miR-136	CLIP-seq
MIRT2438724	hsa-miR-143	CLIP-seq
MIRT2438725	hsa-miR-1587	CLIP-seq
MIRT2438726	hsa-miR-1825	CLIP-seq
MIRT2438727	hsa-miR-199a-3p	CLIP-seq
MIRT2438728	hsa-miR-199a-5p	CLIP-seq
MIRT2438729	hsa-miR-199b-3p	CLIP-seq
MIRT2438730	hsa-miR-199b-5p	CLIP-seq
MIRT2431191	hsa-miR-2110	CLIP-seq
MIRT2438731	hsa-miR-299-3p	CLIP-seq
MIRT2438732	hsa-miR-3129-5p	CLIP-seq
MIRT1153361	hsa-miR-3164	CLIP-seq
MIRT2431192	hsa-miR-3179	CLIP-seq
MIRT2438733	hsa-miR-3184	CLIP-seq
MIRT2438734	hsa-miR-34c-3p	CLIP-seq
MIRT1153362	hsa-miR-3944-5p	CLIP-seq
MIRT2438735	hsa-miR-423-5p	CLIP-seq
MIRT2438736	hsa-miR-4265	CLIP-seq
MIRT2438737	hsa-miR-4270	CLIP-seq
MIRT2431200	hsa-miR-4271	CLIP-seq
MIRT2438738	hsa-miR-4296	CLIP-seq
MIRT2438739	hsa-miR-4322	CLIP-seq
MIRT2438740	hsa-miR-4417	CLIP-seq
MIRT2438741	hsa-miR-4434	CLIP-seq
MIRT2438742	hsa-miR-4441	CLIP-seq
MIRT2438743	hsa-miR-4446-3p	CLIP-seq
MIRT2438744	hsa-miR-4491	CLIP-seq
MIRT2438745	hsa-miR-4492	CLIP-seq
MIRT2438746	hsa-miR-4498	CLIP-seq
MIRT2438747	hsa-miR-4516	CLIP-seq
MIRT2438748	hsa-miR-4531	CLIP-seq
MIRT2438749	hsa-miR-4639-5p	CLIP-seq
MIRT2438750	hsa-miR-4656	CLIP-seq
MIRT2438751	hsa-miR-4657	CLIP-seq
MIRT2438752	hsa-miR-4663	CLIP-seq
MIRT2438753	hsa-miR-4675	CLIP-seq
MIRT2438754	hsa-miR-4677-3p	CLIP-seq
MIRT2438755	hsa-miR-4679	CLIP-seq
MIRT2438756	hsa-miR-4688	CLIP-seq
MIRT2438757	hsa-miR-4708-5p	CLIP-seq
MIRT2438758	hsa-miR-4711-3p	CLIP-seq
MIRT2438759	hsa-miR-4721	CLIP-seq
MIRT2431206	hsa-miR-4725-3p	CLIP-seq
MIRT2438760	hsa-miR-4728-5p	CLIP-seq
MIRT2438761	hsa-miR-4739	CLIP-seq
MIRT2438762	hsa-miR-4741	CLIP-seq
MIRT2438763	hsa-miR-4755-3p	CLIP-seq
MIRT2438764	hsa-miR-4756-5p	CLIP-seq
MIRT2438765	hsa-miR-4763-3p	CLIP-seq
MIRT2438766	hsa-miR-4770	CLIP-seq
MIRT2438767	hsa-miR-4786-3p	CLIP-seq
MIRT2431208	hsa-miR-4790-3p	CLIP-seq
MIRT2438768	hsa-miR-4797-3p	CLIP-seq
MIRT2438769	hsa-miR-485-3p	CLIP-seq
MIRT2438770	hsa-miR-486-3p	CLIP-seq
MIRT2438771	hsa-miR-511	CLIP-seq
MIRT2438772	hsa-miR-562	CLIP-seq
MIRT2431216	hsa-miR-563	CLIP-seq
MIRT1153363	hsa-miR-617	CLIP-seq
MIRT2438773	hsa-miR-664	CLIP-seq
MIRT2438774	hsa-miR-671-5p	CLIP-seq
MIRT2438775	hsa-miR-762	CLIP-seq
MIRT2438776	hsa-miR-936	CLIP-seq
MIRT2431185	hsa-miR-106a	CLIP-seq
MIRT2431186	hsa-miR-106b	CLIP-seq
MIRT2572098	hsa-miR-1179	CLIP-seq
MIRT2572099	hsa-miR-1206	CLIP-seq
MIRT2438718	hsa-miR-1207-5p	CLIP-seq
MIRT2572100	hsa-miR-122	CLIP-seq
MIRT2572101	hsa-miR-1227	CLIP-seq
MIRT2572102	hsa-miR-1237	CLIP-seq
MIRT2438719	hsa-miR-1238	CLIP-seq
MIRT2431187	hsa-miR-124	CLIP-seq
MIRT2572103	hsa-miR-1244	CLIP-seq
MIRT2572104	hsa-miR-1248	CLIP-seq
MIRT2572105	hsa-miR-1251	CLIP-seq
MIRT2438720	hsa-miR-1253	CLIP-seq
MIRT2438721	hsa-miR-1273f	CLIP-seq
MIRT2572106	hsa-miR-1276	CLIP-seq
MIRT2572107	hsa-miR-1299	CLIP-seq
MIRT2438722	hsa-miR-1321	CLIP-seq
MIRT1153360	hsa-miR-1324	CLIP-seq
MIRT2438723	hsa-miR-136	CLIP-seq
MIRT2572108	hsa-miR-139-5p	CLIP-seq
MIRT2438724	hsa-miR-143	CLIP-seq
MIRT2572109	hsa-miR-146b-3p	CLIP-seq
MIRT2572110	hsa-miR-1470	CLIP-seq
MIRT2572111	hsa-miR-1538	CLIP-seq
MIRT2438725	hsa-miR-1587	CLIP-seq
MIRT2431188	hsa-miR-17	CLIP-seq
MIRT2438726	hsa-miR-1825	CLIP-seq
MIRT2572112	hsa-miR-190	CLIP-seq
MIRT2572113	hsa-miR-190b	CLIP-seq
MIRT2572114	hsa-miR-1914	CLIP-seq
MIRT2438728	hsa-miR-199a-5p	CLIP-seq
MIRT2438730	hsa-miR-199b-5p	CLIP-seq
MIRT2431189	hsa-miR-20a	CLIP-seq
MIRT2431190	hsa-miR-20b	CLIP-seq
MIRT2431191	hsa-miR-2110	CLIP-seq
MIRT2572115	hsa-miR-2909	CLIP-seq
MIRT1153364	hsa-miR-296-3p	CLIP-seq
MIRT2438731	hsa-miR-299-3p	CLIP-seq
MIRT2273303	hsa-miR-29a	CLIP-seq
MIRT2273304	hsa-miR-29b	CLIP-seq
MIRT2273305	hsa-miR-29c	CLIP-seq
MIRT2572116	hsa-miR-302f	CLIP-seq
MIRT2572117	hsa-miR-3064-3p	CLIP-seq
MIRT2273306	hsa-miR-3065-3p	CLIP-seq
MIRT2572118	hsa-miR-3065-5p	CLIP-seq
MIRT2572119	hsa-miR-3125	CLIP-seq
MIRT2572120	hsa-miR-3127-5p	CLIP-seq
MIRT2572121	hsa-miR-3148	CLIP-seq
MIRT2572122	hsa-miR-3156-3p	CLIP-seq
MIRT2572123	hsa-miR-3160-3p	CLIP-seq
MIRT1153361	hsa-miR-3164	CLIP-seq
MIRT2572124	hsa-miR-3168	CLIP-seq
MIRT2572125	hsa-miR-3173-5p	CLIP-seq
MIRT2572126	hsa-miR-3177-3p	CLIP-seq
MIRT2431192	hsa-miR-3179	CLIP-seq
MIRT2572127	hsa-miR-3181	CLIP-seq
MIRT2572128	hsa-miR-3182	CLIP-seq
MIRT2438733	hsa-miR-3184	CLIP-seq
MIRT2572129	hsa-miR-3185	CLIP-seq
MIRT2572130	hsa-miR-3187-3p	CLIP-seq
MIRT2572131	hsa-miR-3192	CLIP-seq
MIRT2431193	hsa-miR-3202	CLIP-seq
MIRT2572132	hsa-miR-326	CLIP-seq
MIRT1551365	hsa-miR-330-3p	CLIP-seq
MIRT2572133	hsa-miR-330-5p	CLIP-seq
MIRT2572134	hsa-miR-339-5p	CLIP-seq
MIRT2438734	hsa-miR-34c-3p	CLIP-seq
MIRT2572135	hsa-miR-3611	CLIP-seq
MIRT2431194	hsa-miR-3616-5p	CLIP-seq
MIRT2572136	hsa-miR-3622a-5p	CLIP-seq
MIRT2572137	hsa-miR-3647-3p	CLIP-seq
MIRT2431195	hsa-miR-3647-5p	CLIP-seq
MIRT2572138	hsa-miR-3667-5p	CLIP-seq
MIRT2572139	hsa-miR-3672	CLIP-seq
MIRT2572140	hsa-miR-3675-3p	CLIP-seq
MIRT2572141	hsa-miR-3677-5p	CLIP-seq
MIRT2431196	hsa-miR-3688-5p	CLIP-seq
MIRT2572142	hsa-miR-3689a-3p	CLIP-seq
MIRT2572143	hsa-miR-3689c	CLIP-seq
MIRT2431197	hsa-miR-3714	CLIP-seq
MIRT2572144	hsa-miR-371b-3p	CLIP-seq
MIRT2572145	hsa-miR-376c	CLIP-seq
MIRT2431198	hsa-miR-3910	CLIP-seq
MIRT2572146	hsa-miR-3916	CLIP-seq
MIRT2572147	hsa-miR-3918	CLIP-seq
MIRT2572148	hsa-miR-3920	CLIP-seq
MIRT1153365	hsa-miR-3921	CLIP-seq
MIRT2572149	hsa-miR-3925-3p	CLIP-seq
MIRT2572150	hsa-miR-3973	CLIP-seq
MIRT2438735	hsa-miR-423-5p	CLIP-seq
MIRT2431199	hsa-miR-4263	CLIP-seq
MIRT2438736	hsa-miR-4265	CLIP-seq
MIRT2438737	hsa-miR-4270	CLIP-seq
MIRT2431200	hsa-miR-4271	CLIP-seq
MIRT2572151	hsa-miR-4278	CLIP-seq
MIRT2572152	hsa-miR-4289	CLIP-seq
MIRT2572153	hsa-miR-4290	CLIP-seq
MIRT2431201	hsa-miR-4293	CLIP-seq
MIRT2438738	hsa-miR-4296	CLIP-seq
MIRT2572154	hsa-miR-4301	CLIP-seq
MIRT2572155	hsa-miR-4310	CLIP-seq
MIRT2572156	hsa-miR-4311	CLIP-seq
MIRT2438739	hsa-miR-4322	CLIP-seq
MIRT2438740	hsa-miR-4417	CLIP-seq
MIRT2572157	hsa-miR-4422	CLIP-seq
MIRT2572158	hsa-miR-4428	CLIP-seq
MIRT2438741	hsa-miR-4434	CLIP-seq
MIRT2572159	hsa-miR-4436a	CLIP-seq
MIRT2273307	hsa-miR-4436b-3p	CLIP-seq
MIRT2438742	hsa-miR-4441	CLIP-seq
MIRT1153366	hsa-miR-4443	CLIP-seq
MIRT2438743	hsa-miR-4446-3p	CLIP-seq
MIRT2438744	hsa-miR-4491	CLIP-seq
MIRT2438745	hsa-miR-4492	CLIP-seq
MIRT2572160	hsa-miR-4493	CLIP-seq
MIRT2438746	hsa-miR-4498	CLIP-seq
MIRT2438747	hsa-miR-4516	CLIP-seq
MIRT2431202	hsa-miR-4519	CLIP-seq
MIRT2572161	hsa-miR-452	CLIP-seq
MIRT2431203	hsa-miR-4521	CLIP-seq
MIRT2572162	hsa-miR-4525	CLIP-seq
MIRT2572163	hsa-miR-4529-5p	CLIP-seq
MIRT2431204	hsa-miR-4530	CLIP-seq
MIRT2438748	hsa-miR-4531	CLIP-seq
MIRT2572164	hsa-miR-4639-3p	CLIP-seq
MIRT2438749	hsa-miR-4639-5p	CLIP-seq
MIRT2572165	hsa-miR-4645-5p	CLIP-seq
MIRT1153367	hsa-miR-4649-3p	CLIP-seq
MIRT2572166	hsa-miR-4651	CLIP-seq
MIRT1153368	hsa-miR-4653-5p	CLIP-seq
MIRT1153369	hsa-miR-4654	CLIP-seq
MIRT2438750	hsa-miR-4656	CLIP-seq
MIRT2438751	hsa-miR-4657	CLIP-seq
MIRT2438752	hsa-miR-4663	CLIP-seq
MIRT2572167	hsa-miR-4673	CLIP-seq
MIRT2438753	hsa-miR-4675	CLIP-seq
MIRT2572168	hsa-miR-4676-3p	CLIP-seq
MIRT2438754	hsa-miR-4677-3p	CLIP-seq
MIRT2438755	hsa-miR-4679	CLIP-seq
MIRT2572169	hsa-miR-4684-5p	CLIP-seq
MIRT1551366	hsa-miR-4685-5p	CLIP-seq
MIRT2438756	hsa-miR-4688	CLIP-seq
MIRT2273308	hsa-miR-4690-3p	CLIP-seq
MIRT2572170	hsa-miR-4693-5p	CLIP-seq
MIRT2572171	hsa-miR-4700-3p	CLIP-seq
MIRT2572172	hsa-miR-4701-5p	CLIP-seq
MIRT2438757	hsa-miR-4708-5p	CLIP-seq
MIRT2431205	hsa-miR-4716-3p	CLIP-seq
MIRT2438759	hsa-miR-4721	CLIP-seq
MIRT2431206	hsa-miR-4725-3p	CLIP-seq
MIRT2572173	hsa-miR-4728-3p	CLIP-seq
MIRT2438760	hsa-miR-4728-5p	CLIP-seq
MIRT2572174	hsa-miR-4732-5p	CLIP-seq
MIRT2273309	hsa-miR-4733-3p	CLIP-seq
MIRT2438761	hsa-miR-4739	CLIP-seq
MIRT2438762	hsa-miR-4741	CLIP-seq
MIRT2572175	hsa-miR-4745-3p	CLIP-seq
MIRT2572176	hsa-miR-4747-3p	CLIP-seq
MIRT2431207	hsa-miR-4747-5p	CLIP-seq
MIRT2572177	hsa-miR-4749-3p	CLIP-seq
MIRT2572178	hsa-miR-4753-3p	CLIP-seq
MIRT2438763	hsa-miR-4755-3p	CLIP-seq
MIRT2438764	hsa-miR-4756-5p	CLIP-seq
MIRT2438765	hsa-miR-4763-3p	CLIP-seq
MIRT1153370	hsa-miR-4769-5p	CLIP-seq
MIRT2438766	hsa-miR-4770	CLIP-seq
MIRT2572179	hsa-miR-4783-3p	CLIP-seq
MIRT2438767	hsa-miR-4786-3p	CLIP-seq
MIRT2431208	hsa-miR-4790-3p	CLIP-seq
MIRT2572180	hsa-miR-4795-3p	CLIP-seq
MIRT2431209	hsa-miR-4795-5p	CLIP-seq
MIRT2438770	hsa-miR-486-3p	CLIP-seq
MIRT2572181	hsa-miR-488	CLIP-seq
MIRT2572182	hsa-miR-499a-5p	CLIP-seq
MIRT2431210	hsa-miR-506	CLIP-seq
MIRT2572183	hsa-miR-515-5p	CLIP-seq
MIRT2572184	hsa-miR-516b	CLIP-seq
MIRT2431211	hsa-miR-519a	CLIP-seq
MIRT2431212	hsa-miR-519b-3p	CLIP-seq
MIRT2431213	hsa-miR-519c-3p	CLIP-seq
MIRT2431214	hsa-miR-519d	CLIP-seq
MIRT2431215	hsa-miR-520d-5p	CLIP-seq
MIRT1551367	hsa-miR-520g	CLIP-seq
MIRT1551368	hsa-miR-520h	CLIP-seq
MIRT2572185	hsa-miR-526b	CLIP-seq
MIRT1153371	hsa-miR-541	CLIP-seq
MIRT2572186	hsa-miR-548a-3p	CLIP-seq
MIRT2572187	hsa-miR-548e	CLIP-seq
MIRT2572188	hsa-miR-548f	CLIP-seq
MIRT2572189	hsa-miR-548l	CLIP-seq
MIRT2438772	hsa-miR-562	CLIP-seq
MIRT2431216	hsa-miR-563	CLIP-seq
MIRT2572190	hsa-miR-564	CLIP-seq
MIRT2572191	hsa-miR-566	CLIP-seq
MIRT2431217	hsa-miR-573	CLIP-seq
MIRT2572192	hsa-miR-580	CLIP-seq
MIRT2572193	hsa-miR-583	CLIP-seq
MIRT2572194	hsa-miR-588	CLIP-seq
MIRT2431218	hsa-miR-595	CLIP-seq
MIRT2572195	hsa-miR-604	CLIP-seq
MIRT2572196	hsa-miR-608	CLIP-seq
MIRT1153363	hsa-miR-617	CLIP-seq
MIRT2431219	hsa-miR-625	CLIP-seq
MIRT2572197	hsa-miR-628-5p	CLIP-seq
MIRT2572198	hsa-miR-635	CLIP-seq
MIRT2431220	hsa-miR-644	CLIP-seq
MIRT1153372	hsa-miR-654-5p	CLIP-seq
MIRT2572199	hsa-miR-656	CLIP-seq
MIRT2572200	hsa-miR-661	CLIP-seq
MIRT2438774	hsa-miR-671-5p	CLIP-seq
MIRT2572201	hsa-miR-760	CLIP-seq
MIRT2438775	hsa-miR-762	CLIP-seq
MIRT2043917	hsa-miR-765	CLIP-seq
MIRT2572202	hsa-miR-766	CLIP-seq
MIRT2572203	hsa-miR-873	CLIP-seq
MIRT2572204	hsa-miR-874	CLIP-seq
MIRT2572205	hsa-miR-875-3p	CLIP-seq
MIRT2431221	hsa-miR-885-3p	CLIP-seq
MIRT2431222	hsa-miR-93	CLIP-seq
MIRT2572206	hsa-miR-942	CLIP-seq
MIRT2431185	hsa-miR-106a	CLIP-seq
MIRT2431186	hsa-miR-106b	CLIP-seq
MIRT2572098	hsa-miR-1179	CLIP-seq
MIRT2572099	hsa-miR-1206	CLIP-seq
MIRT2438718	hsa-miR-1207-5p	CLIP-seq
MIRT2572100	hsa-miR-122	CLIP-seq
MIRT2572101	hsa-miR-1227	CLIP-seq
MIRT2572102	hsa-miR-1237	CLIP-seq
MIRT2438719	hsa-miR-1238	CLIP-seq
MIRT2431187	hsa-miR-124	CLIP-seq
MIRT2572103	hsa-miR-1244	CLIP-seq
MIRT2572104	hsa-miR-1248	CLIP-seq
MIRT2572105	hsa-miR-1251	CLIP-seq
MIRT2438720	hsa-miR-1253	CLIP-seq
MIRT2685138	hsa-miR-125a-5p	CLIP-seq
MIRT2685139	hsa-miR-125b	CLIP-seq
MIRT2438721	hsa-miR-1273f	CLIP-seq
MIRT2572106	hsa-miR-1276	CLIP-seq
MIRT2572107	hsa-miR-1299	CLIP-seq
MIRT2438722	hsa-miR-1321	CLIP-seq
MIRT1153360	hsa-miR-1324	CLIP-seq
MIRT2438723	hsa-miR-136	CLIP-seq
MIRT2572108	hsa-miR-139-5p	CLIP-seq
MIRT2438724	hsa-miR-143	CLIP-seq
MIRT2572109	hsa-miR-146b-3p	CLIP-seq
MIRT2572110	hsa-miR-1470	CLIP-seq
MIRT2572111	hsa-miR-1538	CLIP-seq
MIRT2438725	hsa-miR-1587	CLIP-seq
MIRT2431188	hsa-miR-17	CLIP-seq
MIRT2438726	hsa-miR-1825	CLIP-seq
MIRT2572112	hsa-miR-190	CLIP-seq
MIRT2572113	hsa-miR-190b	CLIP-seq
MIRT2572114	hsa-miR-1914	CLIP-seq
MIRT2438728	hsa-miR-199a-5p	CLIP-seq
MIRT2438730	hsa-miR-199b-5p	CLIP-seq
MIRT2431189	hsa-miR-20a	CLIP-seq
MIRT2431190	hsa-miR-20b	CLIP-seq
MIRT2431191	hsa-miR-2110	CLIP-seq
MIRT2685140	hsa-miR-2117	CLIP-seq
MIRT2572115	hsa-miR-2909	CLIP-seq
MIRT1153364	hsa-miR-296-3p	CLIP-seq
MIRT2438731	hsa-miR-299-3p	CLIP-seq
MIRT2273303	hsa-miR-29a	CLIP-seq
MIRT2273304	hsa-miR-29b	CLIP-seq
MIRT2273305	hsa-miR-29c	CLIP-seq
MIRT2572116	hsa-miR-302f	CLIP-seq
MIRT2572117	hsa-miR-3064-3p	CLIP-seq
MIRT2273306	hsa-miR-3065-3p	CLIP-seq
MIRT2572118	hsa-miR-3065-5p	CLIP-seq
MIRT2572119	hsa-miR-3125	CLIP-seq
MIRT2685141	hsa-miR-3126-5p	CLIP-seq
MIRT2572120	hsa-miR-3127-5p	CLIP-seq
MIRT2572121	hsa-miR-3148	CLIP-seq
MIRT2685142	hsa-miR-3150a-5p	CLIP-seq
MIRT2685143	hsa-miR-3150b-5p	CLIP-seq
MIRT2572122	hsa-miR-3156-3p	CLIP-seq
MIRT2572123	hsa-miR-3160-3p	CLIP-seq
MIRT1153361	hsa-miR-3164	CLIP-seq
MIRT2572124	hsa-miR-3168	CLIP-seq
MIRT2572125	hsa-miR-3173-5p	CLIP-seq
MIRT2572126	hsa-miR-3177-3p	CLIP-seq
MIRT2431192	hsa-miR-3179	CLIP-seq
MIRT2572127	hsa-miR-3181	CLIP-seq
MIRT2572128	hsa-miR-3182	CLIP-seq
MIRT2438733	hsa-miR-3184	CLIP-seq
MIRT2572129	hsa-miR-3185	CLIP-seq
MIRT2572130	hsa-miR-3187-3p	CLIP-seq
MIRT2572131	hsa-miR-3192	CLIP-seq
MIRT2431193	hsa-miR-3202	CLIP-seq
MIRT2572132	hsa-miR-326	CLIP-seq
MIRT1551365	hsa-miR-330-3p	CLIP-seq
MIRT2572133	hsa-miR-330-5p	CLIP-seq
MIRT2572134	hsa-miR-339-5p	CLIP-seq
MIRT2438734	hsa-miR-34c-3p	CLIP-seq
MIRT2572135	hsa-miR-3611	CLIP-seq
MIRT2431194	hsa-miR-3616-5p	CLIP-seq
MIRT2572136	hsa-miR-3622a-5p	CLIP-seq
MIRT2572137	hsa-miR-3647-3p	CLIP-seq
MIRT2431195	hsa-miR-3647-5p	CLIP-seq
MIRT2572138	hsa-miR-3667-5p	CLIP-seq
MIRT2572139	hsa-miR-3672	CLIP-seq
MIRT2572140	hsa-miR-3675-3p	CLIP-seq
MIRT2572141	hsa-miR-3677-5p	CLIP-seq
MIRT2431196	hsa-miR-3688-5p	CLIP-seq
MIRT2572142	hsa-miR-3689a-3p	CLIP-seq
MIRT2572143	hsa-miR-3689c	CLIP-seq
MIRT2431197	hsa-miR-3714	CLIP-seq
MIRT2572144	hsa-miR-371b-3p	CLIP-seq
MIRT2572145	hsa-miR-376c	CLIP-seq
MIRT2431198	hsa-miR-3910	CLIP-seq
MIRT2572146	hsa-miR-3916	CLIP-seq
MIRT2572147	hsa-miR-3918	CLIP-seq
MIRT2572148	hsa-miR-3920	CLIP-seq
MIRT1153365	hsa-miR-3921	CLIP-seq
MIRT2572149	hsa-miR-3925-3p	CLIP-seq
MIRT1153362	hsa-miR-3944-5p	CLIP-seq
MIRT2572150	hsa-miR-3973	CLIP-seq
MIRT2438735	hsa-miR-423-5p	CLIP-seq
MIRT2431199	hsa-miR-4263	CLIP-seq
MIRT2438736	hsa-miR-4265	CLIP-seq
MIRT2438737	hsa-miR-4270	CLIP-seq
MIRT2431200	hsa-miR-4271	CLIP-seq
MIRT2572151	hsa-miR-4278	CLIP-seq
MIRT2685144	hsa-miR-4287	CLIP-seq
MIRT2572152	hsa-miR-4289	CLIP-seq
MIRT2572153	hsa-miR-4290	CLIP-seq
MIRT2431201	hsa-miR-4293	CLIP-seq
MIRT2438738	hsa-miR-4296	CLIP-seq
MIRT2572154	hsa-miR-4301	CLIP-seq
MIRT2572155	hsa-miR-4310	CLIP-seq
MIRT2572156	hsa-miR-4311	CLIP-seq
MIRT2685145	hsa-miR-4319	CLIP-seq
MIRT2438739	hsa-miR-4322	CLIP-seq
MIRT2438740	hsa-miR-4417	CLIP-seq
MIRT2572157	hsa-miR-4422	CLIP-seq
MIRT2572158	hsa-miR-4428	CLIP-seq
MIRT2438741	hsa-miR-4434	CLIP-seq
MIRT2572159	hsa-miR-4436a	CLIP-seq
MIRT2273307	hsa-miR-4436b-3p	CLIP-seq
MIRT2438742	hsa-miR-4441	CLIP-seq
MIRT1153366	hsa-miR-4443	CLIP-seq
MIRT2438743	hsa-miR-4446-3p	CLIP-seq
MIRT2685146	hsa-miR-4469	CLIP-seq
MIRT2438744	hsa-miR-4491	CLIP-seq
MIRT2438745	hsa-miR-4492	CLIP-seq
MIRT2572160	hsa-miR-4493	CLIP-seq
MIRT2438746	hsa-miR-4498	CLIP-seq
MIRT2438747	hsa-miR-4516	CLIP-seq
MIRT2431202	hsa-miR-4519	CLIP-seq
MIRT2572161	hsa-miR-452	CLIP-seq
MIRT2431203	hsa-miR-4521	CLIP-seq
MIRT2572162	hsa-miR-4525	CLIP-seq
MIRT2572163	hsa-miR-4529-5p	CLIP-seq
MIRT2431204	hsa-miR-4530	CLIP-seq
MIRT2438748	hsa-miR-4531	CLIP-seq
MIRT2572164	hsa-miR-4639-3p	CLIP-seq
MIRT2438749	hsa-miR-4639-5p	CLIP-seq
MIRT2572165	hsa-miR-4645-5p	CLIP-seq
MIRT1153367	hsa-miR-4649-3p	CLIP-seq
MIRT2572166	hsa-miR-4651	CLIP-seq
MIRT1153368	hsa-miR-4653-5p	CLIP-seq
MIRT1153369	hsa-miR-4654	CLIP-seq
MIRT2438750	hsa-miR-4656	CLIP-seq
MIRT2438751	hsa-miR-4657	CLIP-seq
MIRT2438752	hsa-miR-4663	CLIP-seq
MIRT2572167	hsa-miR-4673	CLIP-seq
MIRT2438753	hsa-miR-4675	CLIP-seq
MIRT2572168	hsa-miR-4676-3p	CLIP-seq
MIRT2438754	hsa-miR-4677-3p	CLIP-seq
MIRT2438755	hsa-miR-4679	CLIP-seq
MIRT2572169	hsa-miR-4684-5p	CLIP-seq
MIRT2685147	hsa-miR-4685-3p	CLIP-seq
MIRT1551366	hsa-miR-4685-5p	CLIP-seq
MIRT2438756	hsa-miR-4688	CLIP-seq
MIRT2273308	hsa-miR-4690-3p	CLIP-seq
MIRT2572170	hsa-miR-4693-5p	CLIP-seq
MIRT2572171	hsa-miR-4700-3p	CLIP-seq
MIRT2572172	hsa-miR-4701-5p	CLIP-seq
MIRT2438757	hsa-miR-4708-5p	CLIP-seq
MIRT2431205	hsa-miR-4716-3p	CLIP-seq
MIRT2438759	hsa-miR-4721	CLIP-seq
MIRT2431206	hsa-miR-4725-3p	CLIP-seq
MIRT2572173	hsa-miR-4728-3p	CLIP-seq
MIRT2438760	hsa-miR-4728-5p	CLIP-seq
MIRT2685148	hsa-miR-4732-3p	CLIP-seq
MIRT2572174	hsa-miR-4732-5p	CLIP-seq
MIRT2273309	hsa-miR-4733-3p	CLIP-seq
MIRT2438761	hsa-miR-4739	CLIP-seq
MIRT2438762	hsa-miR-4741	CLIP-seq
MIRT2572175	hsa-miR-4745-3p	CLIP-seq
MIRT2572176	hsa-miR-4747-3p	CLIP-seq
MIRT2431207	hsa-miR-4747-5p	CLIP-seq
MIRT2572177	hsa-miR-4749-3p	CLIP-seq
MIRT2572178	hsa-miR-4753-3p	CLIP-seq
MIRT2438763	hsa-miR-4755-3p	CLIP-seq
MIRT2438764	hsa-miR-4756-5p	CLIP-seq
MIRT2438765	hsa-miR-4763-3p	CLIP-seq
MIRT1153370	hsa-miR-4769-5p	CLIP-seq
MIRT2438766	hsa-miR-4770	CLIP-seq
MIRT2572179	hsa-miR-4783-3p	CLIP-seq
MIRT2438767	hsa-miR-4786-3p	CLIP-seq
MIRT2431208	hsa-miR-4790-3p	CLIP-seq
MIRT2572180	hsa-miR-4795-3p	CLIP-seq
MIRT2431209	hsa-miR-4795-5p	CLIP-seq
MIRT2438770	hsa-miR-486-3p	CLIP-seq
MIRT2572181	hsa-miR-488	CLIP-seq
MIRT2572182	hsa-miR-499a-5p	CLIP-seq
MIRT2431210	hsa-miR-506	CLIP-seq
MIRT2572183	hsa-miR-515-5p	CLIP-seq
MIRT2572184	hsa-miR-516b	CLIP-seq
MIRT2431211	hsa-miR-519a	CLIP-seq
MIRT2431212	hsa-miR-519b-3p	CLIP-seq
MIRT2431213	hsa-miR-519c-3p	CLIP-seq
MIRT2431214	hsa-miR-519d	CLIP-seq
MIRT2431215	hsa-miR-520d-5p	CLIP-seq
MIRT1551367	hsa-miR-520g	CLIP-seq
MIRT1551368	hsa-miR-520h	CLIP-seq
MIRT2572185	hsa-miR-526b	CLIP-seq
MIRT1153371	hsa-miR-541	CLIP-seq
MIRT2685149	hsa-miR-544b	CLIP-seq
MIRT2572186	hsa-miR-548a-3p	CLIP-seq
MIRT2572187	hsa-miR-548e	CLIP-seq
MIRT2572188	hsa-miR-548f	CLIP-seq
MIRT2572189	hsa-miR-548l	CLIP-seq
MIRT2685150	hsa-miR-550b	CLIP-seq
MIRT2438772	hsa-miR-562	CLIP-seq
MIRT2431216	hsa-miR-563	CLIP-seq
MIRT2572190	hsa-miR-564	CLIP-seq
MIRT2572191	hsa-miR-566	CLIP-seq
MIRT2431217	hsa-miR-573	CLIP-seq
MIRT2685151	hsa-miR-576-5p	CLIP-seq
MIRT2572192	hsa-miR-580	CLIP-seq
MIRT2572193	hsa-miR-583	CLIP-seq
MIRT2572194	hsa-miR-588	CLIP-seq
MIRT2431218	hsa-miR-595	CLIP-seq
MIRT2572195	hsa-miR-604	CLIP-seq
MIRT2572196	hsa-miR-608	CLIP-seq
MIRT1153363	hsa-miR-617	CLIP-seq
MIRT2431219	hsa-miR-625	CLIP-seq
MIRT2572197	hsa-miR-628-5p	CLIP-seq
MIRT2572198	hsa-miR-635	CLIP-seq
MIRT2431220	hsa-miR-644	CLIP-seq
MIRT1153372	hsa-miR-654-5p	CLIP-seq
MIRT2572199	hsa-miR-656	CLIP-seq
MIRT2572200	hsa-miR-661	CLIP-seq
MIRT2685152	hsa-miR-670	CLIP-seq
MIRT2438774	hsa-miR-671-5p	CLIP-seq
MIRT2572201	hsa-miR-760	CLIP-seq
MIRT2438775	hsa-miR-762	CLIP-seq
MIRT2043917	hsa-miR-765	CLIP-seq
MIRT2572202	hsa-miR-766	CLIP-seq
MIRT2572203	hsa-miR-873	CLIP-seq
MIRT2572204	hsa-miR-874	CLIP-seq
MIRT2572205	hsa-miR-875-3p	CLIP-seq
MIRT2431221	hsa-miR-885-3p	CLIP-seq
MIRT2431222	hsa-miR-93	CLIP-seq
MIRT2572206	hsa-miR-942	CLIP-seq

Show/Hide all (37)

Transcription factor	Regulation	Reference
ATF2	Activation	17079470;17258390
ATF3	Repression	11792711;15102941
CEBPE	Unknown	19853299
CREB1	Unknown	10506168
ETS2	Unknown	19939245;22108824
ETV4	Unknown	10506168;15317818
ETV5	Unknown	22968857
EZH2	Activation	21629038
HDAC3	Repression	17079677
HIF1A	Activation	17335808
HIF1A	Repression	17332917;18570733
HOXB7	Activation	21183939
HTATIP2	Repression	19349353
JUN	Activation	15777790
KLF4	Activation	22407433
MSC	Activation	18279606
MZF1	Repression	22846578
NFKB1	Activation	17498959;19303700;20352621
NR4A1	Activation	22551568
PAX6	Unknown	17047041
RELA	Activation	17498959;19303700;20352621
RUNX2	Activation	22641097
SP1	Activation	21469139
SP1	Unknown	10506168;15317818;19853299;21045016
SP3	Unknown	15317818
SRF	Activation	12654640
SSX2	Unknown	15781633
STAT3	Activation	17533737;19284568;20069389
STAT3	Repression	17533737
STAT3	Unknown	16540670
TFAP2A	Unknown	10506168;10589685;19853299;19939245;20145123
TFAP2C	Unknown	19853299
TP53	Activation	10029407;11792711;9343394
TP53	Unknown	19853299;19939245
TWIST1	Activation	20646316
TWIST2	Activation	20646316
YBX1	Unknown	10589685

Show/Hide all (99)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001541	Process	Ovarian follicle development	IEA
GO:0001542	Process	Ovulation from ovarian follicle	IEA
GO:0001553	Process	Luteinization	IEA
GO:0001666	Process	Response to hypoxia	IBA
GO:0001666	Process	Response to hypoxia	IEA
GO:0001666	Process	Response to hypoxia	IEA
GO:0001955	Process	Blood vessel maturation	IEA
GO:0001957	Process	Intramembranous ossification	IEA
GO:0001968	Function	Fibronectin binding	IEA
GO:0004175	Function	Endopeptidase activity	IDA	23845380
GO:0004222	Function	Metalloendopeptidase activity	IBA
GO:0004222	Function	Metalloendopeptidase activity	IEA
GO:0004222	Function	Metalloendopeptidase activity	TAS	2834383
GO:0004252	Function	Serine-type endopeptidase activity	EXP	17428795
GO:0004252	Function	Serine-type endopeptidase activity	TAS
GO:0005515	Function	Protein binding	IPI	12032297, 20979576, 21441952, 25613181, 25897080, 28106549, 28514442, 32296183, 32814053, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	20551380
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	18492766, 24784232
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	2834383
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0006508	Process	Proteolysis	IDA	15863497
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	TAS	2834383
GO:0006979	Process	Response to oxidative stress	IEA
GO:0007162	Process	Negative regulation of cell adhesion	IEA
GO:0007507	Process	Heart development	IEA
GO:0007565	Process	Female pregnancy	IEA
GO:0007566	Process	Embryo implantation	IEA
GO:0007567	Process	Parturition	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IDA	31879982
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	TAS	2834383
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0014012	Process	Peripheral nervous system axon regeneration	IEA
GO:0014823	Process	Response to activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IEA
GO:0016477	Process	Cell migration	IMP	31879982
GO:0016787	Function	Hydrolase activity	IEA
GO:0022617	Process	Extracellular matrix disassembly	IEA
GO:0022617	Process	Extracellular matrix disassembly	TAS	24970228
GO:0030017	Component	Sarcomere	IEA
GO:0030163	Process	Protein catabolic process	IEA
GO:0030198	Process	Extracellular matrix organization	IBA
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0030574	Process	Collagen catabolic process	IBA
GO:0030574	Process	Collagen catabolic process	IEA
GO:0030574	Process	Collagen catabolic process	IEA
GO:0030574	Process	Collagen catabolic process	TAS
GO:0031012	Component	Extracellular matrix	HDA	28327460
GO:0031012	Component	Extracellular matrix	HDA	23979707
GO:0031012	Component	Extracellular matrix	IEA
GO:0032526	Process	Response to retinoic acid	IEA
GO:0034097	Process	Response to cytokine	IEA
GO:0034614	Process	Cellular response to reactive oxygen species	IEA
GO:0035094	Process	Response to nicotine	IEA
GO:0035987	Process	Endodermal cell differentiation	IEA
GO:0035987	Process	Endodermal cell differentiation	IEP	23154389
GO:0042542	Process	Response to hydrogen peroxide	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043627	Process	Response to estrogen	IEA
GO:0045906	Process	Negative regulation of vasoconstriction	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048013	Process	Ephrin receptor signaling pathway	IEA
GO:0048013	Process	Ephrin receptor signaling pathway	TAS
GO:0048246	Process	Macrophage chemotaxis	IEA
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IEA
GO:0048705	Process	Skeletal system morphogenesis	IEA
GO:0048771	Process	Tissue remodeling	IBA
GO:0048771	Process	Tissue remodeling	IEA
GO:0051602	Process	Response to electrical stimulus	IEA
GO:0055093	Process	Response to hyperoxia	IEA
GO:0060325	Process	Face morphogenesis	IEA
GO:0060346	Process	Bone trabecula formation	IEA
GO:0060740	Process	Prostate gland epithelium morphogenesis	IEA
GO:0061450	Process	Trophoblast cell migration	IDA	34432647
GO:0071230	Process	Cellular response to amino acid stimulus	IEA
GO:0071345	Process	Cellular response to cytokine stimulus	IEA
GO:0071347	Process	Cellular response to interleukin-1	IEA
GO:0071392	Process	Cellular response to estradiol stimulus	IEA
GO:0071492	Process	Cellular response to UV-A	IDA	31380578
GO:0071492	Process	Cellular response to UV-A	IEA
GO:0071498	Process	Cellular response to fluid shear stress	IEA
GO:1903378	Process	Positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway	IEA
GO:1904645	Process	Response to amyloid-beta	IEA
GO:1904645	Process	Response to amyloid-beta	ISS
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IEA
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IMP	18667463

MIM	HGNC	e!Ensembl
120360	7166	ENSG00000087245

P08253

Protein name

72 kDa type IV collagenase (EC 3.4.24.24) (72 kDa gelatinase) (Gelatinase A) (Matrix metalloproteinase-2) (MMP-2) (TBE-1) [Cleaved into: PEX]

Protein function

Ubiquitinous metalloproteinase that is involved in diverse functions such as remodeling of the vasculature, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. As well as degrading extracellular matrix

PDB

1CK7 , 1CXW , 1EAK , 1GEN , 1GXD , 1HOV , 1J7M , 1KS0 , 1QIB , 1RTG , 3AYU , 7XGJ , 7XJO , 8H78

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01471	PG_binding_1	43 → 97	Putative peptidoglycan binding domain	Domain
PF00413	Peptidase_M10	118 → 446	Matrixin	Domain
PF00040	fn2	233 → 274	Fibronectin type II domain	Domain
PF00040	fn2	291 → 332	Fibronectin type II domain	Domain
PF00040	fn2	349 → 390	Fibronectin type II domain	Domain
PF00045	Hemopexin	475 → 518	Hemopexin	Repeat
PF00045	Hemopexin	520 → 563	Hemopexin	Repeat
PF00045	Hemopexin	568 → 615	Hemopexin	Repeat
PF00045	Hemopexin	617 → 660	Hemopexin	Repeat

Tissue specificity

TISSUE SPECIFICITY: Produced by normal skin fibroblasts. PEX is expressed in a number of tumors including gliomas, breast and prostate. {ECO:0000269|PubMed:11751392}.

Sequence

MEALMARGALTGPLRALCLLGCLLSHAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGC
PKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWD
KNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGD
GYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFN
GKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGT
SYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKY
ESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGAL
MAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQ
IRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEY
WIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDP
GFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

Sequence length

660

Interactions

View interactions

	KEGG		Reactome
	Endocrine resistance Leukocyte transendothelial migration GnRH signaling pathway Estrogen signaling pathway Relaxin signaling pathway AGE-RAGE signaling pathway in diabetic complications Pathways in cancer Proteoglycans in cancer Bladder cancer Diabetic cardiomyopathy Fluid shear stress and atherosclerosis		Collagen degradation Degradation of the extracellular matrix Activation of Matrix Metalloproteinases Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) EPH-ephrin mediated repulsion of cells Interleukin-4 and Interleukin-13 signaling Extra-nuclear estrogen signaling

141

Show/Hide Causal Diseases (4)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
MMP2-related disorder	Likely pathogenic	rs746668134	RCV003393229
Multicentric osteolysis nodulosis arthropathy spectrum	Likely pathogenic; Pathogenic	rs1962181218, rs745677721, rs2142353661, rs201679510, rs2142349089, rs1369454759, rs1168427805, rs794727916, rs121912954, rs1962580119	RCV001730022 RCV001730023 RCV001805735 RCV001806430 RCV001806439 RCV001837584 RCV002250117 RCV001781537 RCV000018644 RCV001170049
Multicentric osteolysis, nodulosis, and arthropathy	Pathogenic; Likely pathogenic	rs2142358933, rs1369454759, rs794727916, rs121912953, rs121912954, rs121912955, rs2142358692, rs1567378779	RCV003147666 RCV005412282 RCV003147377 RCV004576903 RCV003147301 RCV004576904 RCV004576905 RCV004576906
Ovarian serous cystadenocarcinoma	Likely pathogenic	rs746668134	RCV005932799

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Lip and oral cavity carcinoma	association	rs243865	RCV000493884
Thyroid cancer, nonmedullary, 1	Uncertain significance	rs141440582	RCV005924212

Show/Hide Text Mining Associations (606)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Abortion Spontaneous	Stimulate	36564776
Abortion Spontaneous	Associate	38581334
Achalasia Addisonianism Alacrimia syndrome	Stimulate	23538006
Acne Vulgaris	Associate	31032338
Actinic cheilitis	Associate	26515234
Acute Coronary Syndrome	Stimulate	21273668
Acute Coronary Syndrome	Associate	34859099
Acute Kidney Injury	Associate	25179305
Acute Lung Injury	Associate	19159011
Adenocarcinoma	Associate	11452866, 11786732, 19330734, 25337226, 27331624, 36938549, 37445754
Adenocarcinoma	Stimulate	36928883
Adenocarcinoma Bronchiolo Alveolar	Associate	33070147
Adenocarcinoma Follicular	Associate	22901190
Adenocarcinoma Mucinous	Associate	24737953
Adenocarcinoma of Lung	Associate	16153921, 20671927, 23349885, 23591077, 25816405, 30713254, 35929837, 36171576
Adenoma	Associate	1323219, 23940598
Adenoma Pleomorphic	Associate	22507323, 25137137
Adenomatous Polyposis Coli	Stimulate	10940281
Adenomatous Polyposis Coli	Associate	36270769
Adrenoleukodystrophy	Stimulate	23185624
Airway Obstruction	Associate	34915763
Airway Remodeling	Associate	15265805, 23682108
Albuminuria	Associate	28805547
Alexander Disease	Associate	30973283
Allan Herndon Dudley syndrome	Stimulate	12445230
Allan Herndon Dudley syndrome	Inhibit	9555115
Allergic Fungal Sinusitis	Associate	18712166, 23257253, 31893934
Alopecia	Associate	29913259
Alveolitis Extrinsic Allergic	Associate	31590404
Alzheimer Disease	Inhibit	20561382
Alzheimer Disease	Associate	26284520, 26402409, 33986628, 38538217, 39796199
Ameloblastoma	Associate	18588710, 19096916, 19995435, 25099616, 33067558
Anetoderma	Associate	28116317
Aneurysm	Associate	10957667, 11496285, 14681644, 18971037, 23768831, 26071572, 7674473
Aneurysm	Inhibit	26539497
Aneurysm Ascending Aorta	Stimulate	22571802, 24093773
Aneurysm Ascending Aorta	Associate	26071572
Angiofibroma	Associate	35216046
Angiomyolipoma	Associate	29920561
Ankyloblepharon filiforme adnatum	Associate	27876897
Anodontia	Inhibit	17348445
Anodontia	Associate	24351915
Anorchia	Associate	22321834
Anthracosis	Associate	26528997
Aortic Aneurysm	Associate	28198528, 30530865, 7674473
Aortic Aneurysm Abdominal	Associate	10957667, 11496285, 11877705, 14681644, 14743151, 19515587, 22571802, 24980077, 25854712, 28209269
Aortic Aneurysm Familial Abdominal 1	Associate	21078989
Aortic Aneurysm Thoracic	Stimulate	15876810
Aortic Aneurysm Thoracic	Associate	22010139, 25120286, 25767191, 28678310, 30530865
Aortic Diseases	Associate	23764410
Aortic Dissection	Associate	27759651, 28678310, 7674473
Aortic Valve Disease	Associate	24093773, 32089075
Aortic Valve Insufficiency	Stimulate	34148301
Aortic Valve Stenosis	Stimulate	36362368
Apical Hypertrophic Cardiomyopathy	Associate	35328555
Arteriovenous Fistula	Associate	20724289, 21620625, 36642504
Arthritis	Associate	18985071, 22824140
Arthritis Rheumatoid	Associate	10830778, 16356191, 16507143, 16869002, 17255320, 23632129, 24309559, 26646950, 27498552, 32508836, 33692802, 36398072, 9014820
Arthritis Rheumatoid	Stimulate	34290266
Asthma	Associate	12947131, 23682108, 26074138, 33144422
Astrocytoma	Associate	19775294, 28234925, 32472129
Atherosclerosis	Stimulate	17198804
Atherosclerosis	Associate	20064641, 28193703, 28500763, 32024951, 40076930, 8546199
Atrial Fibrillation	Associate	22001292, 27141955, 32201587, 36398072
Atypical Squamous Cells of the Cervix	Associate	15925946
Autoimmune Diseases	Associate	30344260
Axial osteomalacia	Stimulate	34698138
Barlow syndrome	Associate	28417861
Bicuspid Aortic Valve Disease	Stimulate	17382648, 35439345
Bicuspid Aortic Valve Disease	Associate	27339495, 27634926
Bile Duct Neoplasms	Associate	15682828
Bipolar Disorder	Associate	24402212
Blood Platelet Disorders	Associate	12466243, 14691052, 36135815
Blood Platelet Disorders	Stimulate	22122360
Bloom Syndrome	Stimulate	40016774
Bone Diseases	Associate	23238945, 33748269
Bone Diseases	Stimulate	33778077
Bone Marrow Diseases	Associate	35901359
Bone Resorption	Associate	35363329
Brain Diseases	Associate	21151391
Brain Injuries	Associate	24616914
Brain Injuries Traumatic	Associate	33093584
Brain Ischemia	Stimulate	16098049, 23582094
Breast Carcinoma In Situ	Associate	31530842
Breast Neoplasms	Associate	10571077, 11929863, 14520459, 15054465, 16776850, 16796815, 16929121, 17473389, 17613170, 17725804, 17972522, 19243594, 19454611, 19531263, 19661326 View all (53 more)
Breast Neoplasms	Stimulate	20571065, 23534767, 25317801, 32582965
Breast Neoplasms	Inhibit	25656607, 34360714
Bursitis	Associate	36008780
Calcifying Epithelial Odontogenic Tumor	Associate	21903428
Calcinosis	Associate	23151010
Calcinosis Cutis	Associate	11062605, 24317053, 25764026, 32711429
Calcinosis Cutis	Stimulate	15685621, 18330957
Cancer Pain	Associate	27277077, 28911071
Cap Myopathy	Associate	19233958
Carcinogenesis	Associate	14569466, 21750404, 22901190, 24998576, 25755762, 26561467, 27317771, 27363017, 30484490, 30848576, 30965236
Carcinoid Tumor	Associate	18708724
Carcinoma	Associate	24951956
Carcinoma Adenoid Cystic	Associate	17591960, 22200897
Carcinoma Basal Cell	Associate	27406386, 32354918
Carcinoma Ductal	Associate	16807982, 17473389, 20835647
Carcinoma Ductal Breast	Associate	16807982
Carcinoma Endometrioid	Associate	16309203, 24344400
Carcinoma Endometrioid	Inhibit	17962725
Carcinoma Hepatocellular	Associate	15133868, 16775432, 19140237, 19239691, 20653060, 21909361, 22546345, 22949882, 23179396, 23468978, 23950866, 24083576, 24317053, 24587407, 24614035 View all (32 more)
Carcinoma Hepatocellular	Inhibit	27465549, 36116407, 40650282
Carcinoma Hepatocellular	Stimulate	9736043
Carcinoma Intraductal Noninfiltrating	Associate	20835647
Carcinoma Non Small Cell Lung	Associate	11413356, 11742492, 12393872, 18265895, 20631638, 22072145, 22455335, 22748147, 23580348, 24318272, 24789436, 24793017, 27224551, 27273943, 35978057
Carcinoma Non Small Cell Lung	Inhibit	28945763
Carcinoma Ovarian Epithelial	Associate	16124061, 17314270, 17962725, 19324884, 29949791, 30485902, 32718331
Carcinoma Pancreatic Ductal	Associate	19893036, 25137018, 26850699, 27429508, 28284058, 28475017
Carcinoma Papillary	Stimulate	12001695
Carcinoma Renal Cell	Associate	10454537, 12410931, 12445230, 12657102, 21808237, 23006512, 23281640, 24802708, 24986570, 25031735, 26304749, 27166254, 27806310, 29103203, 31217736 View all (6 more)
Carcinoma Squamous Cell	Associate	10376963, 12218298, 12669237, 14990972, 20874839, 25400809, 26050228, 26515234, 28604655, 31053522, 7961122
Carcinoma Squamous Cell	Stimulate	9685743
Cardiomyopathies	Associate	34859099
Cardiomyopathy Dilated	Associate	10937947, 27890770, 36866790
Cardiomyopathy Hypertrophic	Associate	21890325
Cardiovascular Diseases	Associate	27412873, 28390988, 32455133, 36614132, 36866790
Carotid Stenosis	Stimulate	28500763
Cartilage Diseases	Associate	11762938, 24067484
Cataract	Associate	22259225, 31081067, 31755246, 33832130
Cataract	Stimulate	32180680
Cataract Age Related Nuclear	Inhibit	33760112
Celiac Disease	Associate	15608660
Central Nervous System Diseases	Associate	21569377
Central Nervous System Vascular Malformations	Associate	29431912
Cerebral Amyloid Angiopathy	Associate	12753080, 20576603, 21707819
Cerebral Arterial Diseases	Associate	31273966
Cerebral Hemorrhage	Associate	26551785
Cerebral Infarction	Associate	26617904, 28193703, 30278505, 30657570, 33778069, 34159826
Cerebral Small Vessel Diseases	Associate	28193703
Chagas Cardiomyopathy	Associate	35372112
Chagas Disease	Associate	23856618, 28118356, 31057540, 35372112
Chemical and Drug Induced Liver Injury	Associate	38034020
Cholangiocarcinoma	Associate	19629755, 23480758, 28482619, 30444036, 35792239, 38123132
Cholestasis	Associate	9736043
Cholesteatoma	Associate	22714856, 33778077
Cholesteatoma Congenital	Associate	33778077
Chondrosarcoma	Associate	10473866, 15736455, 22968857, 23320110, 24047437, 24085323
Chorioamnionitis	Stimulate	20136828
Choroidal Neovascularization	Associate	17475706
Chronic Disease	Associate	29267209
Chronic Periodontitis	Associate	10776921, 25826490
Chronic Periodontitis	Stimulate	26063981
Churg Strauss Syndrome	Associate	25004843
Cleft Lip	Associate	24589636, 27876897
Cleft Palate	Associate	35363329
Clubfoot	Associate	35292718
Colitis Ulcerative	Stimulate	10940281
Colitis Ulcerative	Associate	12651627, 21477272
Colonic Neoplasms	Associate	10402168, 25110240, 32813775
Colonic Neoplasms	Stimulate	15918191
Colorectal Neoplasms	Associate	10901373, 11401321, 11786732, 11857296, 15918187, 15991286, 16101153, 16619535, 16916471, 17348445, 17649785, 17876296, 18506186, 18925697, 19445018 View all (56 more)
Complex Regional Pain Syndromes	Associate	33892152
Congenital disorder of glycosylation type 1A	Associate	20625418, 29334797
Conjunctivitis Allergic	Stimulate	26989694
Constriction Pathologic	Stimulate	20348234
Constriction Pathologic	Associate	36642504
Corneal Diseases	Associate	19936308
Corneal Dystrophy Band Shaped	Stimulate	19900203
Corneal Injuries	Associate	19900203, 31022731
Corneal Opacity	Associate	31268248
Coronary Artery Disease	Associate	12103254
Coronary Artery Disease	Inhibit	31886261
Coronary Artery Disease	Stimulate	31929842, 36362368
Coronary Artery Dissection Spontaneous	Associate	33866193
Coronary Disease	Associate	22388798
Coronary Restenosis	Associate	20129576
COVID 19	Associate	34450402, 35040478, 35625532, 36319784, 36913345, 37002634
Coxa Magna	Associate	27930516, 31192258
Coxsackievirus Infections	Associate	34410499
Craniopharyngioma	Associate	24934367
Crohn Disease	Associate	12651627, 21535409
Crohn Disease	Stimulate	22098497
Cystic Fibrosis	Associate	19604728
Death	Associate	25966235
Death	Stimulate	32669083
Dental Caries	Associate	22515887, 32398053, 37031884
Dermatofibrosarcoma	Associate	15387709, 23089320
Descending Thoracic Aortic Aneurysm	Associate	16476613
Diabetes Mellitus	Stimulate	11457723, 16778129, 20348234, 24172699, 27104752
Diabetes Mellitus	Inhibit	19074676
Diabetes Mellitus	Associate	19539633, 32455133, 33338031, 34054346
Diabetes Mellitus Type 2	Stimulate	18182154
Diabetes Mellitus Type 2	Associate	35281591
Diabetic Foot	Associate	26221614, 31184591
Diabetic Ketoacidosis	Associate	26843101
Diabetic Nephropathies	Associate	29123184, 33435900, 36726458, 36896170, 38013385
Diffuse Neurofibrillary Tangles with Calcification	Associate	26402409
Dissection Thoracic Aorta	Associate	22960022, 25304030, 26762140
Drug Related Side Effects and Adverse Reactions	Associate	22072145, 23340649, 27432595
Drug Related Side Effects and Adverse Reactions	Inhibit	34360714
Duane Retraction Syndrome	Associate	17962725
Dupuytren Contracture	Associate	22342364, 22987740
Dysautonomia Familial	Associate	22252855
Dyssegmental dysplasia	Associate	12568417
Ectopia Lentis	Associate	31180551
Ehlers Danlos Syndrome Type IV	Stimulate	28596275
Emphysema	Associate	18723334, 19605697
Encephalitis Japanese	Associate	37026221
Endometrial Hyperplasia	Associate	19249761
Endometrial Neoplasms	Associate	11920503, 12372458, 12631221, 16407419, 17009991, 18644593, 22640183, 22964525, 23099861, 23786715, 24344400, 25308734, 26815505, 27898420, 28871006, 30070342, 33072202 View all (2 more)
Endometrial Neoplasms	Stimulate	18607832
Endometriosis	Stimulate	12372458, 33072202
Endometriosis	Associate	18177649, 19055724, 20100617, 20378112, 23557756, 23855590, 23979130, 24661733, 30981279, 34913072
Enteritis	Associate	15178550
Eosinophilic Esophagitis	Associate	25539192, 31636346
Ependymoma	Associate	18716553
Epidermolysis Bullosa Dystrophica	Associate	12880418
Erythema elevatum diutinum	Stimulate	26293758
Esophageal Achalasia	Associate	30449890
Esophageal and Gastric Varices	Associate	30392570
Esophageal Atresia	Associate	22123559
Esophageal Neoplasms	Associate	12733139, 15931594, 23264224, 24168165, 25724186, 27697099
Esophageal Neoplasms	Stimulate	24022664
Esophageal Squamous Cell Carcinoma	Associate	14569466, 15372476, 20920372, 22522455, 23667687, 25724186, 25966235, 27125974, 28488526, 29693138, 30280774, 33149553, 33909822, 37796690
Esophagitis	Inhibit	14569466
Exfoliation Syndrome	Associate	25312247
Eye Diseases	Associate	23098370
Eyelid Neoplasms	Associate	20553231
Factor XIII Deficiency	Associate	31469059
Familial Primary Pulmonary Hypertension	Stimulate	15863640
Fetal Growth Retardation	Inhibit	24106289
Fetal Growth Retardation	Stimulate	28157488
Fibrocartilaginous embolism	Associate	26337541, 32626912
Fibrosis	Associate	16303001, 23057632, 25906101, 26517016, 27774663, 27881141, 36896170, 39201682, 9659170
Fibrosis	Stimulate	31022731
Fistula	Associate	15082589
Fluorosis Dental	Associate	28079131
Focal Epithelial Hyperplasia of the Oral Mucosa	Associate	23107277
Fraser Syndrome	Associate	19435948
Frontotemporal Dementia	Associate	27594586
Gallbladder Diseases	Associate	12439941
Gallbladder Neoplasms	Associate	12439941, 24863943, 29034777, 34913073
Gastritis	Associate	20333791, 24669030
Gastritis	Stimulate	37958643
Gastrointestinal Diseases	Associate	22072145
Gastrointestinal Neoplasms	Associate	9836483
Gastrointestinal Stromal Tumors	Associate	24935368, 30221743
Genetic Diseases Inborn	Associate	11176137, 15955448
Gestational Trophoblastic Disease	Stimulate	35119039
Giant Cell Arteritis	Associate	17502363, 34204585
Giant Cell Tumor of Bone	Associate	25764026
Glaucoma	Associate	19572226, 39769228
Glaucoma Angle Closure	Stimulate	18323704, 36254076
Glaucoma Open Angle	Stimulate	18323704
Glaucoma Open Angle	Associate	20808730, 22605928, 26539028
Glioblastoma	Associate	12918061, 14631378, 16084059, 19176371, 20448453, 20730561, 24552705, 26299938, 26474590, 27363017, 28470949, 28600709, 29538296, 30353649, 30867563 View all (8 more)
Glioblastoma	Stimulate	28234925
Glioma	Associate	10206300, 10638966, 10996658, 11302334, 12454020, 17490812, 19033423, 19724922, 20448453, 20511184, 20646316, 21205070, 21483125, 21698233, 22362300 View all (27 more)
Glioma	Stimulate	25872784
Gliosarcoma	Associate	22288519
Gliosarcoma	Stimulate	29103203
Gliosis	Associate	35040478
Glomerulonephritis	Inhibit	22845765
Glomerulonephritis IGA	Associate	20529817, 31726998
Glucosephosphate Dehydrogenase Deficiency	Associate	22683940
Granuloma Giant Cell	Associate	29339027
Granulomatosis with Polyangiitis	Stimulate	15547092
Granulosa cell tumor of the ovary	Associate	28390988
HAIR AN syndrome	Stimulate	19724156
Hajdu Cheney Syndrome	Associate	18985071, 31268248
Head and Neck Neoplasms	Associate	24705283, 25313763
Heart Diseases	Associate	18985071, 19523958
Heart Failure	Associate	27551966
Heart Failure Diastolic	Associate	21350055
Hemangioma Cavernous Central Nervous System	Associate	18037806
Hematoma	Associate	26551785
Hemochromatosis	Stimulate	23287320
Hemochromatosis	Associate	9659170
Hemolytic Uremic Syndrome	Associate	23151010
Hemorrhage	Stimulate	15215164
Hemorrhage	Associate	18037806, 20576603, 21707819, 26551785
Hemorrhagic Stroke	Associate	12753080
Hemorrhagic Stroke	Stimulate	21707819
Hepatic Veno Occlusive Disease	Associate	21330458
Hepatitis B	Associate	35868407
Hepatitis C	Stimulate	22951829
Hepatitis C Chronic	Associate	15479690
Hepatopulmonary Syndrome	Associate	30392570
Hereditary Breast and Ovarian Cancer Syndrome	Associate	8446598
Heredodegenerative Disorders Nervous System	Associate	36553576
Hernia	Inhibit	31485641
Hernia Inguinal	Associate	11176137, 16036783
Hidradenitis Suppurativa	Associate	23096596
Histiocytoma Benign Fibrous	Associate	15387709, 23089320
Histiocytoma Malignant Fibrous	Associate	25436070
HIV Infections	Associate	21343147
Hodgkin Disease	Associate	35868407
Hydatidiform Mole	Associate	16884384
Hyperalgesia	Associate	35040478
Hyperplasia	Associate	25115216, 26564800
Hypertension	Stimulate	19698156, 35263399, 35439345
Hypertension	Associate	22388798, 27412873, 28390988, 30684802, 37181702
Hypertension	Inhibit	33760199
Hypertension Pregnancy Induced	Associate	22327101, 26775216
Hypertrophy Left Ventricular	Associate	28390988, 35263399
Hypomagnesemia primary	Associate	15925946
Hypopharyngeal Neoplasms	Associate	31882379, 9555115
Hypoxia	Stimulate	17099219, 17273772, 21640519, 23289374, 23307318, 24106289, 26286316, 28426715, 29218693, 31268159, 31618079, 32858793, 36285283
Hypoxia	Inhibit	19523958, 23965235, 32096196
Hypoxia	Associate	23314174, 29414807, 30646538, 33067558, 35729773
Hypoxia Brain	Stimulate	19426483, 23307318
Hypoxia Brain	Inhibit	19523958
Hypoxia Brain	Associate	22275240, 30646538
Idiopathic Noncirrhotic Portal Hypertension	Associate	30392570
Idiopathic Pulmonary Fibrosis	Associate	18723334, 36221131
IgA Vasculitis	Associate	11678909
IgA Vasculitis	Stimulate	20529817
Ileal Diseases	Associate	18708724
Immune System Diseases	Associate	35901359
Immunoglobulin Light chain Amyloidosis	Associate	16164636
Immunologic Deficiency Syndromes	Associate	28417861
Infections	Inhibit	26443282
Inflammation	Associate	12480917, 12847684, 12947131, 14990972, 19432809, 19454611, 21397857, 22328926, 24395652, 26215036, 26453114, 26762881, 26867675, 27429508, 27589705 View all (18 more)
Inflammation	Stimulate	16106101, 19281093, 31558148, 35372112
Inflammatory Bowel Diseases	Stimulate	10861266
Inflammatory Bowel Diseases	Associate	31652976, 36726458
Influenza Human	Associate	27904034
Insulin Resistance	Associate	38034020
Intervertebral Disc Degeneration	Associate	17680282, 25640554, 30915367, 32626912, 34395625
Intervertebral disc disease	Associate	17680282, 23852912, 40016774
Intraabdominal Infections	Associate	31480453
Intracranial Aneurysm	Associate	23516489, 23768831, 29334797
Intracranial Arteriosclerosis	Associate	34159826
Intrahepatic Cholestasis of Pregnancy	Stimulate	28233754
Ischemic Stroke	Associate	37338050
Joint Diseases	Associate	31268248
Keratoconus	Associate	15105792, 36051483
Kidney Diseases	Associate	17898039
Kidney Neoplasms	Associate	17541305, 33059651, 35399832, 36674555
Krukenberg Tumor	Associate	16124061
Laryngeal Neoplasms	Associate	24357157, 27075652, 31882488, 32719260, 9555115
Laryngitis	Associate	9555115
Leiomyoma	Associate	23814095, 28929861, 29747655, 30015921, 34256950, 37487574, 40280719
LEOPARD Syndrome	Associate	16202218
Leprosy	Associate	20008541
Leprosy	Stimulate	35480232
Leukemia	Associate	12771921, 21705840, 29883990
Leukemia Biphenotypic Acute	Associate	16266864
Leukemia Large Granular Lymphocytic	Associate	15925946
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	1460022
Leukemia Myeloid	Associate	30225259
Leukemia Myeloid Acute	Associate	10233411, 23179400, 26884713, 27039800, 35935313
Leukemic Infiltration	Associate	23179400, 26884713
Lichen Planus Oral	Associate	9649139
Lichen Sclerosus et Atrophicus	Associate	22200256
Lipodermatosclerosis	Stimulate	9804345
Liposarcoma	Associate	11249053, 21598240, 31387924
Liver Cirrhosis	Associate	15479690, 15591520, 21330458, 35650297
Liver Cirrhosis Biliary	Associate	10830778
Liver Diseases	Associate	15479690, 19432809, 8129038
Liver Diseases Alcoholic	Associate	26097608
Liver Neoplasms	Associate	24068394
Lung Diseases Interstitial	Associate	15651999
Lung Injury	Associate	11133492, 19165865, 24447332
Lung Neoplasms	Associate	11452866, 11728453, 11935310, 12087091, 18288638, 19165865, 19643940, 19855090, 19903768, 21151391, 21483125, 21688086, 22158108, 22455335, 23271813 View all (25 more)
Lung Neoplasms	Stimulate	22593690
Lung Neoplasms	Inhibit	26198673
Lupus Erythematosus Systemic	Associate	33093251
Lupus Nephritis	Stimulate	30973283
Lyme Neuroborreliosis	Associate	10675223
Lymphangioleiomyomatosis	Stimulate	15111304
Lymphatic Metastasis	Stimulate	12460468, 17009991, 20563765, 22820140, 25317801, 33115469
Lymphatic Metastasis	Inhibit	15022276
Lymphatic Metastasis	Associate	15918187, 15929171, 16718824, 16796815, 17094486, 19140237, 19445018, 20586027, 23280016, 23685894, 24357157, 28621235, 29917190
Lymphoma	Stimulate	25702581
Lymphoma Extranodal NK T Cell	Associate	14716772
Lymphoma Non Hodgkin	Associate	10477738, 26381542
Lymphoma T Cell Cutaneous	Associate	20625418
Lymphopenia	Associate	37002634
Macular Degeneration	Associate	29381911, 29582818
Malignant mesenchymal tumor	Associate	22288519, 32503225
Marfan Syndrome	Associate	32961817, 37445606
Medulloblastoma	Associate	37821528
Melanoma	Associate	10409657, 10844565, 10998134, 12404291, 15009703, 16397238, 16675961, 16829852, 16946713, 18826517, 20098411, 21397857, 24548268, 24766647, 24920276 View all (21 more)
Melanoma	Stimulate	19305641
Melanoma	Inhibit	26293674
Meningioma	Associate	16894529, 23238945
Meningitis Viral	Associate	19141395
Mesothelioma	Associate	11027427, 33028834
Mesothelioma Malignant	Associate	12612292, 12771921, 16206294, 21802412, 23563849, 29138529, 30316293
Metabolic Syndrome	Associate	38034020
Metrorrhagia	Associate	19249761, 23870474
Migraine Disorders	Associate	23043936
Migraine with Aura	Associate	23043936
Mitral Valve Insufficiency	Associate	39273357
Mitral Valve Prolapse	Associate	39273357
Mouth Diseases	Associate	15651999
Mouth Diseases	Stimulate	20008541
Mouth Neoplasms	Associate	24658023, 25117810, 26036622, 27853937, 30355929, 31387166, 32224968, 32934875, 34204617, 36172677
Moyamoya Disease	Associate	25280484
Multiple Myeloma	Associate	10216103, 17593251, 23387827, 26268417, 29020881, 9269785
Multiple Myeloma	Stimulate	11097203, 35604822
Multiple Sclerosis	Associate	24616914, 24751386, 26768647, 29518260, 30344260
Multiple Sclerosis Relapsing Remitting	Stimulate	24686948
Muscle Neoplasms	Associate	19816602
Mycosis Fungoides	Stimulate	11097203
Myelodysplastic Syndromes	Associate	27039800
Myeloproliferative Disorders	Associate	25684469
Myocardial Infarction	Stimulate	11216828, 24280140, 33593275, 34859099
Myocardial Infarction	Associate	22388798, 22785600, 30657570
Myocardial Stunning	Associate	16202218
Myocarditis	Associate	36398072
Myoma	Associate	26003270
Myopathies Structural Congenital	Stimulate	40497531
Myopia	Associate	23378725, 28630860, 37181702
Myopia	Stimulate	32180680
Myotonic Dystrophy	Stimulate	22171077
Myxoma	Associate	18587209, 22473349
Nasal Polyps	Associate	23257253, 31893934
Nasopharyngeal Carcinoma	Associate	21880183, 25066400, 26453114, 26617707, 29693120, 31691433, 33096744, 35689852, 37563232
Nasopharyngeal Neoplasms	Associate	31243109, 36225172, 37915157
Neoplasm Invasiveness	Associate	16167532, 20109015, 23179396, 29320557
Neoplasm Metastasis	Associate	10027400, 10376963, 10402168, 10409657, 11044366, 11249053, 11340084, 11371496, 11857296, 11925109, 11935310, 12445230, 12771921, 14990972, 15009718 View all (128 more)
Neoplasm Metastasis	Stimulate	11159211, 20950454, 22460086, 24245968, 24850176, 28529342
Neoplasm Metastasis	Inhibit	15022276, 18708724, 19331134
Neoplasm Micrometastasis	Associate	16718824, 23766685
Neoplasms	Associate	10027400, 10376963, 10402168, 10409657, 10450179, 10473866, 10496354, 10620064, 10686978, 10901373, 10996658, 11027427, 11044366, 11097203, 11112341 View all (298 more)
Neoplasms	Stimulate	10551322, 11371737, 12460468, 15685621, 16619545, 18294286, 20563765, 22122360, 22555040, 25804888, 25812648, 26790446, 29103203, 30225259, 31387924
Neoplasms	Inhibit	15928670, 19331134, 31200666, 32224968, 37389973
Neoplasms Adipose Tissue	Associate	31551515
Neoplasms Basal Cell	Associate	14691052, 22122360
Neoplasms Cystic Mucinous and Serous	Stimulate	24737953
Neoplasms Germ Cell and Embryonal	Associate	30315637
Neoplasms Glandular and Epithelial	Associate	11733363
Neoplasms Squamous Cell	Associate	30106155
Neoplasms Unknown Primary	Associate	16220559
Neuralgia	Associate	33834930
Neurilemmoma	Associate	24905332
Neuroblastoma	Associate	19540207, 23563563, 23889963
Neurodegenerative Diseases	Associate	27589705
Neurologic Manifestations	Associate	30657570, 36319784
Neurologic Manifestations	Stimulate	34450402
Neutropenia	Associate	22072145
Nevus	Associate	16829852, 30392570
Nevus	Stimulate	35119039
No Reflow Phenomenon	Stimulate	34727098
Non alcoholic Fatty Liver Disease	Associate	26097608, 38034020
Non ST Elevated Myocardial Infarction	Associate	29141503
Nose Diseases	Associate	23257253
Obesity	Associate	18182154, 19466389, 37181702, 39940809
Obesity	Stimulate	34632798
Obesity Abdominal	Associate	26097608
Ocular Hypertension	Associate	39769228
Odontogenic Tumors	Associate	25158190
Odontoma	Stimulate	19995435
Odontoma	Associate	26899292
Oligospermia	Associate	35901359, 37898840
Optic Neuritis	Associate	30344260
Osteoarthritis	Associate	14730609, 16806998, 19303468, 23965235, 24067484, 24223987, 34208590, 34353059, 35093162, 36471753
Osteoarthritis	Inhibit	23780780
Osteoarthritis Knee	Associate	33903094
Osteoarthropathy Secondary Hypertrophic	Associate	30392570
Osteolysis hereditary multicentric	Associate	17059372, 18985071, 31268248, 37710205
Osteonecrosis	Stimulate	22287106
Osteosarcoma	Associate	11346466, 21750404, 23886165, 23900236, 23940627, 24190483, 25663465, 26823829, 26979530, 27144433, 28750740, 29048621, 31446795, 32033398, 36177059, 38217543, 38538251 View all (2 more)
Ovarian Neoplasms	Associate	11355948, 15557756, 17314270, 18976802, 19324884, 20124444, 20607860, 20649989, 21151448, 21193558, 22471482, 22511598, 22652451, 24245968, 24408020 View all (9 more)
Ovarian Neoplasms	Stimulate	23714001, 28627617, 32547317
Pancreatic Neoplasms	Associate	14760765, 15479693, 19056927, 19266599, 21448903, 22901124, 23538603, 23992308, 24008827, 24354864, 24511528, 25017645, 25137018, 25170871, 25215932 View all (16 more)
Pancreatitis Chronic	Stimulate	30680957
Papillomavirus Infections	Associate	26561467
Parapsoriasis	Associate	20625418
Parkinson Disease	Associate	26844501, 31085228
Paroxysmal ventricular fibrillation	Associate	23557756
Pelvic Inflammatory Disease	Associate	18937938
Pelvic Organ Prolapse	Stimulate	24343133, 26927240
Pelvic Organ Prolapse	Associate	28656271
Periapical Diseases	Associate	22515887
Periodontal Diseases	Associate	10776921, 25826490, 26821679, 35363329
Periodontitis	Stimulate	26821679
Personality Disorders	Associate	11452866, 25750173, 26307680
Pituitary Neoplasms	Associate	16167532, 26286316
Placenta Diseases	Associate	29017408
Plaque Amyloid	Associate	26402409
Plaque Atherosclerotic	Associate	8546199
Pneumonia Aspiration	Associate	30225259
Pneumothorax	Associate	28088269
Polycystic Kidney Autosomal Dominant	Associate	11422734
Polycystic Ovary Syndrome	Associate	34632798, 39796177
Polycystic Ovary Syndrome	Inhibit	35551681
Polycythemia Vera	Associate	25684469
Polyps	Associate	18469510
Posterior Capsular Rupture Ocular	Associate	18436832
Pouchitis	Stimulate	10940281
Pre Eclampsia	Stimulate	19698156, 36361378, 38203296
Pre Eclampsia	Associate	22327101, 22672240, 25065683, 28143958, 29017408, 31519209
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	34555302
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	11380392, 19875168, 25246708, 28719899
Preeclamptic toxemia	Associate	29017408
Primary Immunodeficiency Diseases	Associate	19936308
Primary malignant melanoma of the cervix	Associate	15086734
Primary Myelofibrosis	Stimulate	29359451
Progeria	Associate	21852285
Prostate cancer familial	Associate	31201369
Prostate Cancer Hereditary 3	Associate	14760014
Prostatic Hyperplasia	Associate	22555040, 27331624
Prostatic Neoplasms	Associate	14760014, 15928670, 19578386, 20160036, 22555040, 23424616, 23766685, 24386413, 24589892, 25623427, 26312765, 26564800, 26742965, 29300772, 30520325, 30864712, 32692888, 35650297, 9950685 View all (4 more)
Prostatitis	Associate	22555040, 29271007, 36938549
Protein C Deficiency	Associate	21890325
Pseudoxanthoma Elasticum	Associate	15955448
Psoriasis	Associate	27088930
Pterygium	Associate	21359202, 38418145
Pulmonary Arterial Hypertension	Stimulate	15863640
Pulmonary Arterial Hypertension	Associate	33334933
Pulmonary Disease Chronic Obstructive	Associate	20075389, 20078883, 26126526, 26439471, 36221131
Pulmonary Disease Chronic Obstructive	Stimulate	33070147
Pulmonary Fibrosis	Associate	15651999
Pyoderma Gangrenosum	Associate	20636397
Pyoderma Gangrenosum	Stimulate	21658319
Pyruvate Carboxylase Deficiency Disease	Associate	33458757
Radial Neuropathy	Associate	23151010
Rectal Neoplasms	Associate	10732772, 21212604
Renal Insufficiency	Stimulate	24980077, 38581334
Renal Insufficiency Chronic	Associate	22845765, 37867197
Reperfusion Injury	Associate	34057033, 36555091
Retinal Dysplasia	Associate	14569466
Retinal Vein Occlusion	Associate	36180575
Retinitis	Associate	16565411
Retinoblastoma	Associate	23077401, 27488116, 30024608, 32152631
Rheumatoid Nodule	Associate	31268248
Root Resorption	Associate	39596178
Rotator Cuff Injuries	Associate	31444797
Rupture	Associate	19096916
Rupture	Stimulate	23538006
Salivary Gland Neoplasms	Associate	25412957, 27569079
Sarcoidosis	Associate	21959615
Sarcoma	Associate	11249053, 19875755, 21983934, 23661254, 23900236, 24085323, 24190483, 25436070, 31510956
Sarcoma Endometrial Stromal	Associate	10450179
Scleroderma Systemic	Associate	24982919, 31268248, 33334933
Seminoma	Associate	38069214
Severe Acute Respiratory Syndrome	Associate	28779012, 31192912
Sialadenitis	Associate	15901067
Sinus Thrombosis Intracranial	Associate	29431912
Sleep Apnea Obstructive	Associate	25753939
Small Cell Lung Carcinoma	Associate	19643940, 19903768, 24722482, 26050228, 35441564
Smith McCort Dysplasia	Associate	31254341
Soft Tissue Injuries	Associate	12947131
Solitary Fibrous Tumors	Associate	21630198
Spinal Cord Injuries	Associate	17594482
Spinal Stenosis	Associate	19885059
Squamous Cell Carcinoma of Head and Neck	Associate	12404284, 15247230, 16424893, 18349846, 18853752, 19241124, 21174909, 23107277, 24658023, 25117810, 26036622, 26666815, 26874697, 27021541, 27853937 View all (12 more)
Squamous Cell Carcinoma of Head and Neck	Inhibit	15274394
Squamous Cell Carcinoma of Head and Neck	Stimulate	26434905
Squamous Intraepithelial Lesions	Associate	12669237
Stomach Neoplasms	Associate	12172043, 12174360, 12460468, 15929171, 16718824, 16731602, 16940985, 17094486, 18468407, 19586554, 20333791, 20563765, 20950454, 21052891, 21483125 View all (32 more)
Stomach Neoplasms	Stimulate	18330957, 24669030, 40597264
Stomach Ulcer	Associate	34492072
Stroke	Associate	19292924, 20222942, 28193703, 30278505
Sucrase isomaltase deficiency congenital	Inhibit	19165865
Sweet Syndrome	Associate	20636397, 21658319
Synovitis	Associate	11062605, 31268248
Tarlov Cysts	Associate	15682828
Tendinopathy	Stimulate	14554207
Tertiary Lymphoid Structures	Associate	21174909, 23107277, 23280016, 24535905, 26434905
Tertiary Lymphoid Structures	Stimulate	25313763
Thrombosis	Associate	12393408, 23127983, 40724896
Thymic epithelial tumor	Associate	14584061
Thymoma	Associate	14584061
Thyroid cancer medullary	Associate	36156766
Thyroid Cancer Papillary	Stimulate	20306451
Thyroid Cancer Papillary	Associate	22820140, 23685894, 24667444, 24778099, 28731152, 30272290
Thyroid Carcinoma Anaplastic	Associate	29734379
Thyroid Diseases	Associate	25812648
Thyroid Neoplasms	Associate	17158762, 19589279, 20306451, 21493587, 22641097, 27082011, 28709407, 35849996
Thyroid Nodule	Associate	25812648
Thyroiditis	Associate	22820140
Tongue Diseases	Associate	28559016
Tongue Neoplasms	Associate	21174909, 27431199
Tooth Erosion	Associate	11062605
Tourette Syndrome	Stimulate	25772244
Triple Negative Breast Neoplasms	Associate	26537583, 27038254, 32242230, 32332626, 32582965, 34787047, 37217473, 37879215, 39819723
Triple Negative Breast Neoplasms	Stimulate	34108545
Trophoblastic Neoplasms	Associate	34955534
Tuberculosis	Associate	21569377
Tuberculosis Central Nervous System	Associate	21569377
Ulcer	Stimulate	24618232
Uremia	Associate	37867197
Urethral Neoplasms	Associate	26307680, 28940965
Urinary Bladder Diseases	Associate	21931970, 25402510
Urinary Bladder Neoplasms	Associate	20586027, 22960341, 24448324, 24573199, 25884322, 27317771, 27631965, 28846829, 29237912, 31401412, 33234027, 33604385, 33650650, 34354794, 35563650, 35777025, 36293387, 37932474 View all (3 more)
Uterine Cervical Dysplasia	Associate	16619570, 20109015, 24804816
Uterine Cervical Neoplasms	Associate	10486468, 11710594, 15989693, 16619570, 16788844, 16803520, 23679328, 23922932, 23967226, 24804816, 25250801, 26148476, 26191191, 26332389, 26526578 View all (14 more)
Uterine Cervical Neoplasms	Stimulate	15665394, 22438955
Uterine Cervicitis	Stimulate	15086734
Uterine Hemorrhage	Associate	36564776
Uveal melanoma	Associate	11371496, 25184134, 27255356, 34587931
Varicose Ulcer	Associate	16169261, 36250733
Varicose Ulcer	Stimulate	27460704
Varicose Veins	Stimulate	18971037
Varicose Veins	Associate	19703751, 24785109, 28818228, 32096196, 32594304
Varicose Veins	Inhibit	24505358
Vascular Calcification	Associate	23151010
Vascular Diseases	Associate	38203296
Vascular Remodeling	Associate	25120286, 35372112
Vascular System Injuries	Associate	31254341
Vasculitis	Associate	17898039
Venous Insufficiency	Associate	11700497
Venous Thrombosis	Associate	32156832, 35107490
Ventricular Remodeling	Associate	21817815, 27126693
Virus Diseases	Associate	36398072
Vocal Cord Paralysis	Associate	18469510
Weight Loss	Associate	12771921, 28578327, 37487574
Winchester syndrome	Associate	17059372
Wounds and Injuries	Associate	29217818, 34057033

MMP2 (matrix metallopeptidase 2)