Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4312
Gene name	Matrix metallopeptidase 1
Gene symbol	MMP1
Synonyms (NCBI Gene)	CLGCLGN
Chromosome	11
Chromosome location	11q22.2
Summary	This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and t

153

Show/Hide all (153)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000136	hsa-miR-222-3p	FlowLuciferase reporter assayMicroarrayqRT-PCRWestern blot	19487542
MIRT006062	hsa-miR-203a-3p	ELISAqRT-PCR	21279994
MIRT006062	hsa-miR-203a-3p	ELISAqRT-PCR	21279994
MIRT006062	hsa-miR-203a-3p	ELISAqRT-PCR	21279994
MIRT006062	hsa-miR-203a-3p	ELISAqRT-PCR	21279994
MIRT006062	hsa-miR-203a-3p	ELISAqRT-PCR	21279994
MIRT006062	hsa-miR-203a-3p	ELISAqRT-PCR	21279994
MIRT021518	hsa-miR-145-5p	Reporter assay;Microarray	21351259
MIRT731775	hsa-miR-526b-3p	Luciferase reporter assayqRT-PCRWestern blot	26292968
MIRT731775	hsa-miR-526b-3p	Luciferase reporter assayqRT-PCRWestern blot	26292968
MIRT735068	hsa-miR-27a-5p	Luciferase reporter assayWestern blottingMicroarrayImmunofluorescenceqRT-PCRFlow cytometry	32790210
MIRT735328	hsa-miR-100-5p	MicroarrayqRT-PCRELISA	32299427
MIRT2273238	hsa-miR-4774-3p	CLIP-seq
MIRT2438634	hsa-miR-1228	CLIP-seq
MIRT2438635	hsa-miR-1238	CLIP-seq
MIRT2438636	hsa-miR-1976	CLIP-seq
MIRT2438637	hsa-miR-2116	CLIP-seq
MIRT2438638	hsa-miR-3120-5p	CLIP-seq
MIRT2438639	hsa-miR-3140-3p	CLIP-seq
MIRT2438640	hsa-miR-3160-3p	CLIP-seq
MIRT2438641	hsa-miR-3671	CLIP-seq
MIRT2438642	hsa-miR-431	CLIP-seq
MIRT2438643	hsa-miR-4421	CLIP-seq
MIRT2438644	hsa-miR-4432	CLIP-seq
MIRT2438645	hsa-miR-4487	CLIP-seq
MIRT2438646	hsa-miR-4652-3p	CLIP-seq
MIRT2438647	hsa-miR-4677-5p	CLIP-seq
MIRT2438648	hsa-miR-4691-5p	CLIP-seq
MIRT2438649	hsa-miR-4753-3p	CLIP-seq
MIRT2438650	hsa-miR-526b	CLIP-seq
MIRT2438651	hsa-miR-548u	CLIP-seq
MIRT2438652	hsa-miR-558	CLIP-seq
MIRT2438653	hsa-miR-587	CLIP-seq
MIRT2438654	hsa-miR-593	CLIP-seq
MIRT2438655	hsa-miR-607	CLIP-seq
MIRT2571980	hsa-let-7a	CLIP-seq
MIRT2571981	hsa-let-7b	CLIP-seq
MIRT2571982	hsa-let-7c	CLIP-seq
MIRT2571983	hsa-let-7d	CLIP-seq
MIRT2571984	hsa-let-7e	CLIP-seq
MIRT2571985	hsa-let-7f	CLIP-seq
MIRT2571986	hsa-let-7g	CLIP-seq
MIRT2571987	hsa-let-7i	CLIP-seq
MIRT2438635	hsa-miR-1238	CLIP-seq
MIRT2571988	hsa-miR-1248	CLIP-seq
MIRT2571989	hsa-miR-127-5p	CLIP-seq
MIRT2571990	hsa-miR-1299	CLIP-seq
MIRT2571991	hsa-miR-153	CLIP-seq
MIRT2571992	hsa-miR-190	CLIP-seq
MIRT2571993	hsa-miR-190b	CLIP-seq
MIRT2438636	hsa-miR-1976	CLIP-seq
MIRT2571994	hsa-miR-202	CLIP-seq
MIRT2438637	hsa-miR-2116	CLIP-seq
MIRT2438638	hsa-miR-3120-5p	CLIP-seq
MIRT2571995	hsa-miR-3121-3p	CLIP-seq
MIRT2438639	hsa-miR-3140-3p	CLIP-seq
MIRT2571996	hsa-miR-3148	CLIP-seq
MIRT2571997	hsa-miR-3156-5p	CLIP-seq
MIRT2438640	hsa-miR-3160-3p	CLIP-seq
MIRT2571998	hsa-miR-3176	CLIP-seq
MIRT2571999	hsa-miR-3192	CLIP-seq
MIRT2572000	hsa-miR-3201	CLIP-seq
MIRT2572001	hsa-miR-326	CLIP-seq
MIRT2572002	hsa-miR-330-5p	CLIP-seq
MIRT2572003	hsa-miR-3664-5p	CLIP-seq
MIRT2572004	hsa-miR-3922-3p	CLIP-seq
MIRT2572005	hsa-miR-4277	CLIP-seq
MIRT2572006	hsa-miR-4307	CLIP-seq
MIRT2438642	hsa-miR-431	CLIP-seq
MIRT2572007	hsa-miR-4314	CLIP-seq
MIRT2572008	hsa-miR-4420	CLIP-seq
MIRT2438643	hsa-miR-4421	CLIP-seq
MIRT2438644	hsa-miR-4432	CLIP-seq
MIRT2572009	hsa-miR-4458	CLIP-seq
MIRT2572010	hsa-miR-448	CLIP-seq
MIRT2438645	hsa-miR-4487	CLIP-seq
MIRT2572011	hsa-miR-4500	CLIP-seq
MIRT2572012	hsa-miR-450b-3p	CLIP-seq
MIRT2572013	hsa-miR-450b-5p	CLIP-seq
MIRT2572014	hsa-miR-4635	CLIP-seq
MIRT2572015	hsa-miR-4646-5p	CLIP-seq
MIRT2438646	hsa-miR-4652-3p	CLIP-seq
MIRT2438647	hsa-miR-4677-5p	CLIP-seq
MIRT2438648	hsa-miR-4691-5p	CLIP-seq
MIRT2572016	hsa-miR-4713-3p	CLIP-seq
MIRT2572017	hsa-miR-4714-5p	CLIP-seq
MIRT2438649	hsa-miR-4753-3p	CLIP-seq
MIRT2572018	hsa-miR-4791	CLIP-seq
MIRT2572019	hsa-miR-488	CLIP-seq
MIRT2438650	hsa-miR-526b	CLIP-seq
MIRT2572020	hsa-miR-539	CLIP-seq
MIRT2438651	hsa-miR-548u	CLIP-seq
MIRT2438652	hsa-miR-558	CLIP-seq
MIRT2572021	hsa-miR-570	CLIP-seq
MIRT2438654	hsa-miR-593	CLIP-seq
MIRT2572022	hsa-miR-638	CLIP-seq
MIRT2572023	hsa-miR-668	CLIP-seq
MIRT2572024	hsa-miR-759	CLIP-seq
MIRT2572025	hsa-miR-769-3p	CLIP-seq
MIRT2572026	hsa-miR-873	CLIP-seq
MIRT2572027	hsa-miR-875-3p	CLIP-seq
MIRT2572028	hsa-miR-891b	CLIP-seq
MIRT2572029	hsa-miR-9	CLIP-seq
MIRT2572030	hsa-miR-98	CLIP-seq
MIRT2571980	hsa-let-7a	CLIP-seq
MIRT2571981	hsa-let-7b	CLIP-seq
MIRT2571982	hsa-let-7c	CLIP-seq
MIRT2571983	hsa-let-7d	CLIP-seq
MIRT2571984	hsa-let-7e	CLIP-seq
MIRT2571985	hsa-let-7f	CLIP-seq
MIRT2571986	hsa-let-7g	CLIP-seq
MIRT2571987	hsa-let-7i	CLIP-seq
MIRT2438635	hsa-miR-1238	CLIP-seq
MIRT2571989	hsa-miR-127-5p	CLIP-seq
MIRT2571992	hsa-miR-190	CLIP-seq
MIRT2571993	hsa-miR-190b	CLIP-seq
MIRT2438636	hsa-miR-1976	CLIP-seq
MIRT2571994	hsa-miR-202	CLIP-seq
MIRT2438637	hsa-miR-2116	CLIP-seq
MIRT2438638	hsa-miR-3120-5p	CLIP-seq
MIRT2438639	hsa-miR-3140-3p	CLIP-seq
MIRT2438640	hsa-miR-3160-3p	CLIP-seq
MIRT2571999	hsa-miR-3192	CLIP-seq
MIRT2572000	hsa-miR-3201	CLIP-seq
MIRT2572001	hsa-miR-326	CLIP-seq
MIRT2572002	hsa-miR-330-5p	CLIP-seq
MIRT2572006	hsa-miR-4307	CLIP-seq
MIRT2438642	hsa-miR-431	CLIP-seq
MIRT2572007	hsa-miR-4314	CLIP-seq
MIRT2572008	hsa-miR-4420	CLIP-seq
MIRT2438643	hsa-miR-4421	CLIP-seq
MIRT2438644	hsa-miR-4432	CLIP-seq
MIRT2572009	hsa-miR-4458	CLIP-seq
MIRT2438645	hsa-miR-4487	CLIP-seq
MIRT2572011	hsa-miR-4500	CLIP-seq
MIRT2572012	hsa-miR-450b-3p	CLIP-seq
MIRT2572014	hsa-miR-4635	CLIP-seq
MIRT2572015	hsa-miR-4646-5p	CLIP-seq
MIRT2438646	hsa-miR-4652-3p	CLIP-seq
MIRT2438647	hsa-miR-4677-5p	CLIP-seq
MIRT2438648	hsa-miR-4691-5p	CLIP-seq
MIRT2572016	hsa-miR-4713-3p	CLIP-seq
MIRT2438649	hsa-miR-4753-3p	CLIP-seq
MIRT2572018	hsa-miR-4791	CLIP-seq
MIRT2572019	hsa-miR-488	CLIP-seq
MIRT2438650	hsa-miR-526b	CLIP-seq
MIRT2438651	hsa-miR-548u	CLIP-seq
MIRT2438652	hsa-miR-558	CLIP-seq
MIRT2438654	hsa-miR-593	CLIP-seq
MIRT2572022	hsa-miR-638	CLIP-seq
MIRT2572023	hsa-miR-668	CLIP-seq
MIRT2572025	hsa-miR-769-3p	CLIP-seq
MIRT2572030	hsa-miR-98	CLIP-seq

Show/Hide all (29)

Transcription factor	Regulation	Reference
BACH1	Activation	21873975
CEBPB	Unknown	19723873
CITED2	Repression	12960175
ETS1	Activation	15972796;16278291;17283078
ETS1	Unknown	10949659;11556732;21244711
ETS2	Unknown	21244711
ETV3	Unknown	10913304
ETV4	Unknown	9794472
FLI1	Repression	15972796
FOS	Activation	19028685
FOS	Unknown	9334186
FOSL1	Unknown	18802113
GATA3	Unknown	21244711
JUN	Activation	19028685;19708869;20225236
JUN	Unknown	9334186
MAZ	Activation	19028685
NFKB1	Activation	16278291;16385502
NFKB1	Unknown	11376631;16210649
NFKBIA	Unknown	11376631
NR4A2	Repression	17283078
PAX5	Repression	22105368
PPARG	Unknown	15090544
RELA	Activation	16278291;16385502
RELA	Unknown	11376631;16210649
RFWD2	Repression	12615916
STAT3	Unknown	16205632;17460772;21410405
TP53	Repression	15108353
TWIST1	Unknown	23222305
ZNF410	Unknown	12370286

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004175	Function	Endopeptidase activity	IDA	19022250
GO:0004175	Function	Endopeptidase activity	IEA
GO:0004222	Function	Metalloendopeptidase activity	IBA
GO:0004222	Function	Metalloendopeptidase activity	IDA	9920899
GO:0004222	Function	Metalloendopeptidase activity	IEA
GO:0004222	Function	Metalloendopeptidase activity	TAS	3027129
GO:0004252	Function	Serine-type endopeptidase activity	TAS
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0006508	Process	Proteolysis	IDA	15863497, 19022250
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	TAS	2167156
GO:0008233	Function	Peptidase activity	IDA	23845380
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	TAS	2167156
GO:0016787	Function	Hydrolase activity	IEA
GO:0022617	Process	Extracellular matrix disassembly	TAS
GO:0030198	Process	Extracellular matrix organization	IBA
GO:0030574	Process	Collagen catabolic process	IBA
GO:0030574	Process	Collagen catabolic process	IEA
GO:0030574	Process	Collagen catabolic process	TAS
GO:0031012	Component	Extracellular matrix	IEA
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IDA	19022250
GO:0046872	Function	Metal ion binding	IEA
GO:0071492	Process	Cellular response to UV-A	IDA	31380578

MIM	HGNC	e!Ensembl
120353	7155	ENSG00000196611

P03956

Protein name

Interstitial collagenase (EC 3.4.24.7) (Fibroblast collagenase) (Matrix metalloproteinase-1) (MMP-1) [Cleaved into: 22 kDa interstitial collagenase; 27 kDa interstitial collagenase]

Protein function

Cleaves collagens of types I, II, and III at one site in the helical domain. Also cleaves collagens of types VII and X (PubMed:1645757, PubMed:2153297, PubMed:2557822). In case of HIV infection, interacts and cleaves the secreted viral Tat prote

PDB

1AYK , 1CGE , 1CGF , 1CGL , 1HFC , 1SU3 , 2AYK , 2CLT , 2J0T , 2TCL , 3AYK , 3SHI , 4AUO , 4AYK , 966C

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01471	PG_binding_1	27 → 87	Putative peptidoglycan binding domain	Domain
PF00413	Peptidase_M10	108 → 261	Matrixin	Domain
PF00045	Hemopexin	284 → 326	Hemopexin	Repeat
PF00045	Hemopexin	328 → 372	Hemopexin	Repeat
PF00045	Hemopexin	377 → 424	Hemopexin	Repeat
PF00045	Hemopexin	426 → 466	Hemopexin	Repeat

Sequence

MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPV
VEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIEN
YTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGN
LAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSY
TFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDR
FYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGY
PKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFP
GIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN

Sequence length

469

Interactions

View interactions

	KEGG		Reactome
	PPAR signaling pathway IL-17 signaling pathway Relaxin signaling pathway Coronavirus disease - COVID-19 Pathways in cancer Bladder cancer Rheumatoid arthritis Lipid and atherosclerosis		Collagen degradation Degradation of the extracellular matrix Activation of Matrix Metalloproteinases Basigin interactions Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) Interleukin-4 and Interleukin-13 signaling

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Cervical cancer	Benign	rs1051121	RCV005898313
Cholangiocarcinoma	Benign	rs17882844, rs1051121	RCV005923641 RCV005898316
COPD, severe early onset	Likely benign	rs143788145	RCV002501473
Gastric cancer	Benign	rs1051121	RCV005898314
Interstitial lung disease 2	Uncertain significance	rs753853224	RCV000677219
Malignant tumor of esophagus	Benign	rs17882844, rs1051121	RCV005923638 RCV005898312
Melanoma	Benign	rs1051121	RCV005898315
MMP1-related disorder	Likely benign; Benign; Uncertain significance	rs374421543, rs12282811, rs757959653, rs59142365, rs143788145, rs139018071	RCV003897413 RCV003939732 RCV003971759 RCV003970673 RCV003940714 RCV005365706
Preterm premature rupture of membranes	Benign	rs5794198	RCV000988627
PULMONARY DISEASE, CHRONIC OBSTRUCTIVE, RATE OF DECLINE OF LUNG FUNCTION IN	Benign	rs1591085064	RCV000018649
Recessive dystrophic epidermolysis bullosa	Likely benign	rs143788145	RCV002501473
Sarcoma	Benign	rs17882844	RCV005923639
Uterine carcinosarcoma	Benign	rs17882844	RCV005923640
Uterine corpus endometrial carcinoma	Benign	rs1051121	RCV005898317

Show/Hide Text Mining Associations (399)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Achondrogenesis type 2	Associate	31277141
Acidosis	Stimulate	35414794
Acne Vulgaris	Associate	16528362, 18563181
Actinic cheilitis	Associate	26515234
Acute Coronary Syndrome	Associate	29044936
Adenocarcinoma	Associate	19321798, 20946664, 21143918, 27460729, 30670912, 33905434
Adenocarcinoma	Stimulate	22422400
Adenocarcinoma Mucinous	Associate	29463039
Adenocarcinoma of Lung	Associate	29463039, 33487115
Adenocarcinoma Scirrhous	Associate	8766524
Adenoma	Associate	17125518
Adenoma	Stimulate	28376625
Adenomatous Polyposis Coli	Stimulate	10940281
Adjustment Disorders	Associate	29317790
Allergic Fungal Sinusitis	Associate	28398769
Allergic Fungal Sinusitis	Stimulate	31653934
Alopecia	Associate	29913259
Alveolitis Extrinsic Allergic	Associate	31590404
Alzheimer Disease	Inhibit	17660861
Alzheimer Disease	Associate	33892965
Anemia Sickle Cell	Associate	32009522
Aneurysm	Stimulate	14612207
Aneurysm	Associate	26443282, 29291905, 30497276, 34968687
Angina Unstable	Associate	29044936
Anterior Wall Myocardial Infarction	Associate	11877705
Anthracosis	Associate	26528997
Aortic Aneurysm Abdominal	Stimulate	11877705
Aortic Aneurysm Abdominal	Associate	27362269, 28209269, 29291905, 34968687
Aortic Aneurysm Thoracic	Associate	29291905
Aortic Valve Insufficiency	Associate	33029260
Apical Hypertrophic Cardiomyopathy	Associate	35328555
Arterial Occlusive Diseases	Associate	14612207
Arthritis	Associate	21715326, 21801306, 26510114, 27052781, 30440036
Arthritis Juvenile	Associate	26510114, 34963488
Arthritis Psoriatic	Stimulate	34305455
Arthritis Rheumatoid	Associate	10206959, 10531073, 10617637, 10693865, 11259586, 11840439, 11966774, 12379519, 14730602, 15142265, 16207318, 16385502, 16519794, 17009243, 17848581 View all (12 more)
Arthritis Rheumatoid	Stimulate	35955467
Asthma	Associate	19337515, 24587395, 26074138, 26851968, 38148093
Asthma	Stimulate	31653934
Astrocytoma	Associate	27043542
Atherosclerosis	Associate	11805151, 16580524, 16876267
Atrioventricular Block	Associate	32555355
Bacterial Infections	Associate	17363400
Barrett Esophagus	Associate	20946664, 30670912
Basal Cell Nevus Syndrome	Associate	19287498
Basal Cell Nevus Syndrome	Stimulate	24369017
Blister	Associate	7539470
Bone Cysts	Associate	23809184
Bone Diseases	Associate	17363400, 23238945
Bone Diseases	Stimulate	17593251
Brain Injuries Traumatic	Associate	33093584
Breast Diseases	Associate	22011282
Breast Neoplasms	Associate	10889910, 15739263, 17695512, 18366705, 18503039, 19531263, 19661326, 20126581, 20412339, 21344163, 21834986, 22011282, 22627808, 23696797, 24409301 View all (20 more)
Breast Neoplasms	Stimulate	21835023, 23568046, 23762835
Breast Neoplasms	Inhibit	29695550
Bronchiectasis	Associate	23776649
Bronchiolitis Obliterans Syndrome	Associate	26476349
Bronchitis	Associate	34459757
Calcifying Epithelial Odontogenic Tumor	Associate	21903428
Calcinosis Cutis	Associate	17695512, 19634113, 34313250
Cap Myopathy	Associate	16619495
Carcinogenesis	Associate	17125518, 22086466, 31302419, 31537868, 32437034, 33888009
Carcinoma Basal Cell	Associate	34171070
Carcinoma Bronchogenic	Associate	19337515
Carcinoma Ductal	Associate	19916023
Carcinoma Hepatocellular	Associate	21665914, 21909684, 28387651, 28683186, 32951492, 35865652, 35948625, 36458010, 37309005, 40611075
Carcinoma Intraductal Noninfiltrating	Associate	20127359, 22011282, 26215578
Carcinoma Merkel Cell	Associate	37207705
Carcinoma Non Small Cell Lung	Associate	15754326, 22993337, 31181055, 32703314, 33046043, 35227278, 36222298
Carcinoma Pancreatic Ductal	Associate	31731384, 35414794, 37821678
Carcinoma Renal Cell	Associate	19551141, 37563650, 40386045
Carcinoma Renal Cell	Inhibit	23139422
Carcinoma Signet Ring Cell	Associate	20032387
Carcinoma Squamous Cell	Associate	10362121, 12218298, 20874839, 24356192, 26515234, 33888009, 34301206, 34369270, 9649139
Carcinoma Verrucous	Associate	20614262
Cardiomyopathy Dilated	Associate	16095497
Cardiomyopathy Dilated	Inhibit	29250654
Cardiovascular Diseases	Associate	23497408
Carotid Stenosis	Associate	26254334, 27017522, 30789935, 32101136
Cartilage Diseases	Associate	14558091, 25263345, 26045200, 27245218, 30033738, 30551507, 40076528
Celiac Disease	Stimulate	15608660
Cerebral Infarction	Associate	34984852
Cerebrovascular Disorders	Associate	21224082
Chemical and Drug Induced Liver Injury	Associate	29151327
Chondrosarcoma	Associate	14554220, 15927440, 20102637, 23892595, 24472657, 29316907
Chorioamnionitis	Associate	17940116
Choroidal Effusions	Stimulate	15640330
Choroidal Effusions	Associate	26367274, 39390512
Chronic Periodontitis	Associate	22401717, 30945680
Coinfection	Stimulate	30679661
Colitis Collagenous	Associate	10433942
Colitis Ulcerative	Stimulate	10861266, 10940281
Colitis Ulcerative	Associate	12651627, 17009408, 17990358, 33299870
Collagen Diseases	Associate	12929747, 30440036
Colonic Neoplasms	Associate	32813775
Colonic Polyps	Associate	28376625
Colorectal Neoplasms	Associate	10794801, 16739355, 17311017, 22027145, 22363134, 25541970, 28687755, 29342159, 29973580, 32641980, 33893077, 34034060, 35456495, 36036380, 36789689
Conjunctivitis Allergic	Stimulate	26989694
Constriction Pathologic	Associate	8774133
Contracture	Associate	31467177
Corneal Diseases	Associate	19936308, 28631887
Corneal Injuries	Associate	31022731
Coronary Artery Disease	Associate	17893005
Coronary Disease	Associate	22388798, 27323171
Coronary Restenosis	Associate	8774133
COVID 19	Associate	35855804, 37309005
Craniocerebral Trauma	Associate	26120586
Crohn Disease	Stimulate	10861266, 15804950
Crohn Disease	Associate	12651627
Cystic Fibrosis	Stimulate	19604728
Cystic Fibrosis	Associate	26485688
Cytokine Release Syndrome	Stimulate	11352241
Death	Associate	31844116
Depressive Disorder Major	Inhibit	17660861
Dermatitis Herpetiformis	Associate	11247893, 7636299, 8980278
Dermatofibrosarcoma	Associate	15387709
Desmoid disease hereditary	Associate	15054469
Diabetes Mellitus	Associate	22055260, 26988924, 29992758
Diabetes Mellitus	Stimulate	27104752
Diabetes Mellitus Type 2	Stimulate	17714581
Diabetes Mellitus Type 2	Associate	27323171
Diabetic Foot	Associate	35013299
Disease	Associate	27659527
Disease	Stimulate	9862821
Dissection Blood Vessel	Associate	19664242
Diverticular Diseases	Stimulate	24681094
Dowling Degos Disease	Associate	18439317
Dupuytren Contracture	Associate	17336841, 22987740, 23554969, 24293067
Dyssegmental dysplasia	Associate	12568417
Emphysema	Associate	16997735, 17363767, 18259971, 18617682, 19337515, 19605697, 23900981, 24792232, 27313452
Empyema	Stimulate	15640330
Endoleak	Associate	34968687
Endometrial Neoplasms	Associate	10874213, 18644593, 22853432, 27898420
Endometriosis	Associate	16210018, 19055724, 22024213, 32299427
Enteritis	Associate	15178550
Epidermolysis Bullosa Dystrophica	Associate	12880418, 8143767
Erythema elevatum diutinum	Associate	26293758
Esophageal Neoplasms	Stimulate	20946664
Esophageal Neoplasms	Associate	26631031
Esophageal Squamous Cell Carcinoma	Associate	11161388, 22086466, 27436512, 37635445, 39256753
Esophageal Squamous Cell Carcinoma	Stimulate	20686364
Exfoliation Syndrome	Associate	20038976, 20808730, 25312247, 33099542
Familial cylindromatosis	Associate	20946664
Fatigue Syndrome Chronic	Stimulate	33243243
Fibrocartilaginous embolism	Associate	26337541, 26505388, 35315493, 36077518
Fibrosis	Associate	21715326, 23776649, 26367274, 26476349, 30448122, 31022731
Fibrous Dysplasia Polyostotic	Associate	19220835
Fistula	Associate	15082589
Gallbladder Neoplasms	Associate	21039987
Gastroesophageal Reflux	Associate	22422400, 37907428
Gastrointestinal Stromal Tumors	Associate	24379393
Gingival Diseases	Associate	31743516
Gingivitis	Associate	30327948
Glaucoma	Associate	20089870, 22615763, 26120586
Glaucoma Angle Closure	Stimulate	18323704
Glaucoma Angle Closure	Associate	23441116
Glaucoma Open Angle	Stimulate	18323704, 26120586
Glaucoma Open Angle	Associate	20808730, 21709637, 23441116, 23800300
Glioblastoma	Associate	21595984, 25825051
Glioma	Associate	19489099, 37335645
Glomerulonephritis	Inhibit	22845765
Glomerulonephritis Membranous	Associate	35172688
Gout	Associate	36451451
Granuloma	Associate	20111728
Granulosa cell tumor of the ovary	Associate	19442604
HAIR AN syndrome	Stimulate	19724156
Haspeslagh Fryns Muelenaere syndrome	Associate	16049334
Head and Neck Neoplasms	Associate	12404284
Head and Neck Neoplasms	Stimulate	21108787
Heart Diseases	Associate	18617682
Heart Failure	Inhibit	29784904
Heart Failure	Associate	31844116
Heart Failure Systolic	Stimulate	16814653
Hemangioblastoma	Associate	19551141
Hemangiosarcoma	Associate	20661412
Hemochromatosis	Associate	9659170
Hemorrhage	Associate	9240251
Hepatitis B	Associate	21835023
Hepatitis C	Stimulate	30679661
Hepatitis C Chronic	Associate	32050950
Hereditary Breast and Ovarian Cancer Syndrome	Associate	26215578
Hip Injuries	Associate	17363400
Histiocytoma Benign Fibrous	Associate	15387709
Histiocytosis Langerhans Cell	Associate	23074278
Hypercholesterolemia	Associate	29291905
Hypercholesterolemia	Stimulate	35168639
Hyperplasia	Associate	20614262
Hypertension	Associate	16814653
Hypoxia	Stimulate	17099219, 19661326, 20102637, 25217834, 25861162, 27245780, 28426715
Hypoxia	Inhibit	23965235
Hypoxia	Associate	24927122
Idiopathic Pulmonary Fibrosis	Associate	33046043, 33672678, 33905434, 36221131, 36998092, 37907428
Immune Reconstitution Inflammatory Syndrome	Stimulate	24136296
Immune System Diseases	Associate	24927122
Immunoglobulin Light chain Amyloidosis	Associate	16164636
Infections	Associate	20111728, 30786281, 32417757
Infections	Stimulate	26443282, 31470617
Inflammation	Stimulate	11216828, 26829555, 32530982, 33390545
Inflammation	Associate	11450703, 11877705, 12847684, 12928151, 14730602, 15640153, 15640330, 16528362, 19723873, 21563952, 22203690, 22297496, 23283995, 23428978, 23497408 View all (28 more)
Inflammatory Bowel Diseases	Associate	10861266, 19137636, 36647141
Intervertebral Disc Degeneration	Associate	25640554, 26505388, 27706715, 28497435, 31408735, 32829335, 36817437
Intervertebral Disc Degeneration	Stimulate	26782559
Intervertebral disc disease	Associate	18439317, 25640554, 27706715, 31408735
Intervertebral Disc Displacement	Associate	32556014, 39933558
Joint Diseases	Associate	15142265, 24751211
Kashin Beck Disease	Associate	25263345, 27245218
Keratitis	Associate	28573109
Keratoconus	Stimulate	21031023
Keratoconus	Associate	22413749, 27207902, 36051483
Keratosis Actinic	Associate	10362121
Kidney Failure Chronic	Associate	22401717
Kidney Neoplasms	Associate	17980059
Kininogen Deficiency High Molecular Weight and Low Molecular Weight	Associate	35327656
Labor Pain	Associate	28954603
Laryngeal Neoplasms	Associate	32636440
Lead Poisoning Nervous System	Associate	22992722
Leiomyoma	Associate	22853432, 23814095
Leukemic Infiltration	Associate	9197533
Lichen Planus Oral	Associate	30327948
Lipodermatosclerosis	Stimulate	9804345
Liver Cirrhosis	Associate	14606082, 16474379, 35035671, 35715541
Liver Cirrhosis	Inhibit	33737203
Liver Cirrhosis Biliary	Associate	14730602, 15142265
Liver Diseases	Associate	8129038
Lung Diseases	Associate	19337515, 22992722, 25599395, 27245780
Lung Diseases	Stimulate	32396269
Lung Diseases Interstitial	Associate	28002595, 33446609
Lung Injury	Associate	27659527
Lung Neoplasms	Associate	1457364, 19643940, 19723873, 21523769, 22993337, 25149157, 27232698, 27659527, 9877171
Lung Neoplasms	Stimulate	26198673
Lupus Erythematosus Systemic	Associate	31156624
Lupus Nephritis	Stimulate	30973283
Lyme Disease	Associate	15102798
Lymphangioleiomyomatosis	Stimulate	15111304
Lymphangioleiomyomatosis	Associate	17616646
Lymphatic Metastasis	Associate	18507028, 20946664, 22086466, 24505369, 33819484, 33893077
Lymphatic Metastasis	Stimulate	28122331, 29436615, 35456495
Lymphoma	Associate	18954439
Melanoma	Associate	11159206, 11997078, 14519134, 15009703, 15184373, 16829852, 22198560, 23222305, 27007357, 33980846, 38527983, 9194570
Melanoma	Stimulate	21119930
Melanoma Cutaneous Malignant	Associate	20655738, 22198560
Melanosis	Associate	35840442
Meningioma	Associate	25269045
Mesothelioma	Associate	11027427, 20661412
Mesothelioma Malignant	Associate	12612292
Mitral Valve Prolapse Myxomatous 1	Stimulate	34258920
Mouth Diseases	Associate	16210018, 32461624, 9240251
Mouth Diseases	Stimulate	17594482
Mouth Neoplasms	Associate	17352267, 22297602, 36510962
Multiple Myeloma	Associate	10620064, 17593251, 26545722, 9269785
Myelodysplastic Syndromes	Inhibit	28262842
Myocardial Infarction	Associate	11216828, 16210545, 35912721
Myocardial Ischemia	Associate	35912721
Myocarditis	Associate	36226312
Nasal Polyps	Associate	25390332, 28398769
Nasopharyngeal Carcinoma	Associate	28672814, 31302419, 34293937, 34544905
Nasopharyngeal Carcinoma	Stimulate	33564686
Nasopharyngeal Neoplasms	Associate	37915157
Necrosis	Associate	22511625
Neointima	Associate	20827277
Neoplasm Invasiveness	Associate	21523769
Neoplasm Metastasis	Associate	10794801, 11159206, 11259586, 11997078, 15927440, 16474379, 17342087, 21523769, 21640141, 21665914, 21801306, 21909684, 23222305, 23675494, 24264315 View all (16 more)
Neoplasm Metastasis	Inhibit	19331134
Neoplasm Metastasis	Stimulate	35456495
Neoplasms	Associate	10362121, 10794801, 10874213, 11027427, 11159206, 11161388, 11168802, 11259586, 11997078, 12060661, 12218298, 12404284, 14554220, 1457364, 15140235 View all (78 more)
Neoplasms	Stimulate	15754326, 21338529, 24356192, 31200666, 32636440, 32945508, 35806108
Neoplasms	Inhibit	19331134
Nephrogenic Fibrosing Dermopathy	Associate	20714270
Nerve Degeneration	Associate	10206959, 25640554
Nerve Sheath Neoplasms	Associate	16619545
Neurilemmoma	Associate	16619545
Neurodegenerative Diseases	Associate	27604189
Neurofibroma	Inhibit	34011935
Neurofibrosarcoma	Associate	16619545
Nevus	Associate	16829852
Non alcoholic Fatty Liver Disease	Stimulate	29151327
Non alcoholic Fatty Liver Disease	Associate	34988225, 38390691
Obesity	Associate	21952248, 23497408
Obesity	Inhibit	29784904
Obstetric Labor Premature	Stimulate	28954603
Ocular Hypertension	Associate	20089870
Odontogenic Tumors	Associate	25158190
Oral Submucous Fibrosis	Associate	20930336
Orofacial Cleft 1	Associate	21052871
Osteoarthritis	Inhibit	11966774, 14730609, 20517696, 23965235
Osteoarthritis	Associate	12379519, 12882354, 14558091, 14697681, 15743480, 16806998, 21194467, 23809184, 24225084, 25501175, 29863238, 30177524, 30563239, 32095874, 34078001, 34547432 View all (1 more)
Osteoarthritis	Stimulate	25432384, 30597276, 35955467
Osteoarthritis Knee	Associate	24838892, 30177524, 33903094
Osteogenesis Imperfecta	Associate	37021796
Osteomyelitis	Associate	19821768, 29049163
Osteoporosis	Associate	31389576
Osteosarcoma	Associate	21640141
Ovarian Neoplasms	Associate	22652451, 9240251
Pain	Associate	30597276
Pain	Stimulate	33792957
Pancreatic Neoplasms	Associate	10362099, 22160930, 23608755, 25483099, 34114996, 35414794
Pancreatic Neoplasms	Stimulate	27435927
Pancreatitis	Associate	23608755
Pancreatitis Chronic	Associate	23608755
Pelvic Organ Prolapse	Associate	20102291, 23108733, 28849117, 31116709
Pelvic Organ Prolapse	Stimulate	34036402
Penile Neoplasms	Associate	28122331
Periapical Diseases	Associate	27556208
Periodontitis	Associate	25861162, 26988924, 31444694
Peripheral Arterial Disease	Associate	34968687
Peripheral Arterial Occlusive Disease 1	Associate	17598820
Peritonitis	Associate	18507028
Persistent Infection	Stimulate	28954603
Personality Disorders	Associate	22011282
Personality Disorders	Stimulate	24356192
Placenta Previa	Associate	37434137
Plaque Atherosclerotic	Associate	11342575, 22880008, 29992758, 8774133
Pleurisy	Associate	26367274
Pneumothorax	Associate	17616646
Polyarteritis Nodosa	Stimulate	17393409
Polycystic Ovary Syndrome	Associate	15866608
Polyps	Stimulate	28398769
Post Infectious Disorders	Stimulate	26403997
Pouchitis	Stimulate	10940281
Pre Eclampsia	Associate	21224082, 25065683, 26438597
Preeclamptic toxemia	Stimulate	21224082
Premature Birth	Associate	17940116
Preterm Premature Rupture of the Membranes	Associate	11741975
Primary Immunodeficiency Diseases	Associate	19936308
Prostatic Intraepithelial Neoplasia	Inhibit	16619495
Prostatic Neoplasms	Associate	19610059, 26337460, 29845254, 32669958, 36524848
Prostatic Neoplasms Castration Resistant	Associate	38099475
Prostatitis	Associate	23774214
Prosthesis Failure	Associate	17363400
Pseudomyxoma Peritonei	Associate	38232629
Pterygium	Associate	32218695
Pulmonary Disease Chronic Obstructive	Associate	19337515, 20075389, 21245013, 22739086, 22993337, 24792232, 27313452, 28949773, 36221131
Pulmonary Disease Chronic Obstructive	Stimulate	30789935
Q Fever	Associate	28179203, 33243243
Renal Insufficiency	Associate	17363400
Renal Insufficiency Chronic	Associate	19406964, 22845765
Respiratory Sounds	Associate	34459757
Respiratory Tract Diseases	Associate	21245013
Retinal Perforations	Stimulate	27604189
Retinitis	Associate	19551141
Retinopathy of Prematurity	Associate	37894989
Rheumatic Heart Disease	Associate	29458338
Root Resorption	Associate	39596178
Rotator Cuff Injuries	Stimulate	21108787
Sarcoma	Associate	21801306
Sarcoma Ewing	Associate	14550555
Scleroderma Systemic	Associate	13130479, 23041765, 24289089, 28002595
Sepsis	Associate	17363400
Silicosis	Associate	37875355
Simpson Golabi Behmel syndrome	Stimulate	25079398
Sleep Disorders Circadian Rhythm	Associate	21835023
Spinal Cord Injuries	Associate	17594482
Spondylitis Ankylosing	Associate	18678577
Squamous Cell Carcinoma of Head and Neck	Associate	12404284, 1323216, 15274394, 17352267, 17919326, 18254958, 19487542, 19835631, 20614262, 21694466, 21960692, 22580338, 24278120, 24321173, 27797381 View all (13 more)
Squamous Cell Carcinoma of Head and Neck	Stimulate	22809838, 32437034
Stiff Skin Syndrome	Associate	23794948
Stomach Neoplasms	Associate	16707434, 18468407, 18507028, 20563765, 22655095, 22677901, 23847441, 24260584, 24505369, 24927122, 25253367, 31151932, 32866138, 33437215, 37957566, 9197533 View all (1 more)
Stomach Ulcer	Associate	34492072
Stroke	Stimulate	32009522
Synovial Cyst	Associate	17763406
Synovitis	Associate	39390512
Tarlov Cysts	Associate	35806108
Temporomandibular Joint Disorders	Associate	39933558
Temporomandibular Joint Dysfunction Syndrome	Associate	32556014, 36445911
Tendinopathy	Associate	26156631
Tertiary Lymphoid Structures	Associate	22086466
Thoracic Diseases	Associate	29291905, 33029260
Thrombocytosis	Associate	29420626
Thrombophilia	Associate	17352267
Thrombosis	Associate	12393408
Thyroid Carcinoma Anaplastic	Associate	27796151
Tobacco Use Disorder	Associate	17352267, 18617682
Tongue Neoplasms	Associate	19138406
Tooth Erosion	Associate	11508424
Tourette Syndrome	Stimulate	25772244
Trichothiodystrophy Syndromes	Associate	25605938
Triple Negative Breast Neoplasms	Associate	21835023
Tuberculosis	Associate	19337515, 19915152, 20111728, 22992722, 26268658, 28129430, 29420060
Tuberculosis	Stimulate	25635689
Tuberculosis Meningeal	Associate	27245780
Tuberculosis Multidrug Resistant	Stimulate	28334049
Tuberculosis Pulmonary	Associate	20111728, 22992722, 25635689
Tuberculosis Spinal	Associate	28129430
Ulcer	Associate	11259586, 21801306, 24618232
Univentricular Heart	Associate	37770592
Urinary Bladder Neoplasms	Associate	20826916, 25043669, 34410940, 9683296
Urinary Incontinence Stress	Associate	30715578
Uterine Cervical Neoplasms	Associate	21338529, 27034707, 29436615, 30283446, 34116656
Uveal melanoma	Stimulate	34587931
Varicose Ulcer	Associate	27460704
Varicose Veins	Associate	12844106
Varicose Veins	Inhibit	24505358
Vasculitis Leukocytoclastic Cutaneous	Stimulate	32461624
Ventricular Dysfunction Left	Associate	35912721
Ventricular Remodeling	Associate	11216828
von Hippel Lindau Disease	Associate	19551141
Weight Loss	Associate	37738560
Wounds and Injuries	Associate	10531073
Wounds and Injuries	Inhibit	33093584

MMP1 (matrix metallopeptidase 1)