Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4306
Gene name Gene Name - the full gene name approved by the HGNC.
Nuclear receptor subfamily 3 group C member 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NR3C2
Synonyms (NCBI Gene) Gene synonyms aliases
MCR, MLR, MR, NR3C2VIT
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q31.23
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes the mineralocorticoid receptor, which mediates aldosterone actions on salt and water balance within restricted target cells. The protein functions as a ligand-dependent transcription factor that binds to mineralocorticoid response elemen
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs41511344 G>A,T Pathogenic Stop gained, intron variant, missense variant, coding sequence variant
rs121912562 G>A,C Pathogenic Stop gained, coding sequence variant, non coding transcript variant, missense variant
rs121912563 A>G Pathogenic Missense variant, coding sequence variant, genic downstream transcript variant, non coding transcript variant
rs121912564 G>T Pathogenic Stop gained, coding sequence variant, non coding transcript variant
rs121912565 T>C Pathogenic Missense variant, coding sequence variant, intron variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT001167 hsa-miR-135a-5p Luciferase reporter assay, qRT-PCR 19944075
MIRT001168 hsa-miR-124-3p Luciferase reporter assay, qRT-PCR 19944075
MIRT017785 hsa-miR-335-5p Microarray 18185580
MIRT019372 hsa-miR-148b-3p Microarray 17612493
MIRT001164 hsa-miR-19b-3p Sequencing 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0003700 Function DNA-binding transcription factor activity TAS 3037703
GO:0003707 Function Steroid hormone receptor activity TAS 9662404
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600983 7979 ENSG00000151623
Protein
UniProt ID P08235
Protein name Mineralocorticoid receptor (MR) (Nuclear receptor subfamily 3 group C member 2)
Protein function Receptor for both mineralocorticoids (MC) such as aldosterone and glucocorticoids (GC) such as corticosterone or cortisol. Binds to mineralocorticoid response elements (MRE) and transactivates target genes. The effect of MC is to increase ion an
PDB 1Y9R , 1YA3 , 2A3I , 2AA2 , 2AA5 , 2AA6 , 2AA7 , 2AAX , 2AB2 , 2ABI , 2OAX , 3VHU , 3VHV , 3WFF , 3WFG , 4PF3 , 4TNT , 4UDA , 4UDB , 5HCV , 5L7E , 5L7G , 5L7H , 5MWP , 5MWY , 6GEV , 6GG8 , 6GGG , 6L88
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00105 zf-C4 601 670 Zinc finger, C4 type (two domains) Domain
PF00104 Hormone_recep 757 946 Ligand-binding domain of nuclear hormone receptor Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. Highly expressed in distal tubules, convoluted tubules and cortical collecting duct in kidney, and in sweat glands. Detected at lower levels in cardiomyocytes, in epidermis and in colon enterocytes. {ECO:0000269|PubMed:1151
Sequence
METKGYHSLPEGLDMERRWGQVSQAVERSSLGPTERTDENNYMEIVNVSCVSGAIPNNST
QGSSKEKQELLPCLQQDNNRPGILTSDIKTELESKELSATVAESMGLYMDSVRDADYSYE
QQNQQGSMSPAKIYQNVEQLVKFYKGNGHRPSTLSCVNTPLRSFMSDSGSSVNGGVMRAV
VKSPIMCHEKSPSVCSPLNMTSSVCSPAGINSVSSTTASFGSFPVHSPITQGTPLTCSPN
VENRGSRSHSPAHASNVGSPLSSPLSSMKSSISSPPSHCSVKSPVSSPNNVTLRSSVSSP
ANINNSRCSVSSPSNTNNRSTLSSPAASTVGSICSPVNNAFSYTASGTSAGSSTLRDVVP
SPDTQEKGAQEVPFPKTEEVESAISNGVTGQLNIVQYIKPEPDGAFSSSCLGGNSKINSD
SSFSVPIKQESTKHSCSGTSFKGNPTVNPFPFMDGSYFSFMDDKDYYSLSGILGPPVPGF
DGNCEGSGFPVGIKQEPDDGSYYPEASIPSSAIVGVNSGGQSFHYRIGAQGTISLSRSAR
DQSFQHLSSFPPVNTLVESWKSHGDLSSRRSDGYPVLEYIPENVSSSTLRSVSTGSSRPS
KICLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRL
QKCLQAGMNL
GARKSKKLGKLKGIHEEQPQQQQPPPPPPPPQSPEEGTTYIAPAKEPSVN
TALVPQLSTISRALTPSPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQV
VKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKM
HQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYI
KELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTF
RESHALKVEFPAML
VEIISDQLPKVESGNAKPLYFHRK
Sequence length 984
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Aldosterone-regulated sodium reabsorption   HSP90 chaperone cycle for steroid hormone receptors (SHR)
Nuclear Receptor transcription pathway
SUMOylation of intracellular receptors
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Cardiomyopathy Cardiomyopathy, Dilated, Cardiomyopathy, Familial Idiopathic rs267607003, rs267607002, rs267607004, rs63750743, rs121908333, rs121908334, rs104894655, rs121434420, rs121434421, rs193922674, rs111517471, rs121908987, rs193922384, rs121909374, rs121909377
View all (900 more)
21321305
Colorectal cancer Colorectal Carcinoma rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800
View all (467 more)
Hyperaldosteronism Hyperaldosteronism rs28934586, rs104894068, rs387906778, rs386352319, rs587777437, rs587777438, rs587777439, rs786205050, rs771507094, rs1085307938, rs1553853557, rs1553856214, rs1293789661, rs1553857113, rs758379595
Hypertension Hypertensive disease rs13306026
Unknown
Disease term Disease name Evidence References Source
Congestive heart failure Congestive heart failure 15722665, 21321305 ClinVar
Endometriosis Endometriosis 22138541 ClinVar
Heart failure Heart failure, Left-Sided Heart Failure, Heart Failure, Right-Sided 21321305, 15722665 ClinVar
Hypertension with exacerbation in pregnancy Hypertension, Early-Onset, Autosomal Dominant, with Severe Exacerbation in Pregnancy 12483305, 10884226, 19325532, 15908963, 15967794 ClinVar
Associations from Text Mining
Disease Name Relationship Type References
Abortion Spontaneous Associate 26260058
Adenocarcinoma Associate 36829221
Adenoma Associate 24516561
Adenoma Inhibit 35270010
Adenomatous Polyposis Coli Associate 24191286
Alzheimer Disease Associate 21653223
Anxiety Associate 31908177
Arrhythmias Cardiac Associate 36612333
Asthma Associate 23334005
Atherosclerosis Associate 18467630, 20508287, 28555959