Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4303
Gene name	Forkhead box O4
Gene symbol	FOXO4
Synonyms (NCBI Gene)	AFXAFX1MLLT7
Chromosome	X
Chromosome location	Xq13.1
Summary	This gene encodes a member of the O class of winged helix/forkhead transcription factor family. Proteins encoded by this class are regulated by factors involved in growth and differentiation indicating they play a role in these processes. A translocation

Show/Hide all (77)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006698	hsa-miR-499a-5p	Luciferase reporter assayqRT-PCRWestern blot	21934092
MIRT018590	hsa-miR-335-5p	Microarray	18185580
MIRT039705	hsa-miR-615-3p	CLASH	23622248
MIRT437900	hsa-miR-421	Luciferase reporter assayWestern blot	23707940
MIRT437900	hsa-miR-421	Luciferase reporter assayWestern blot	23707940
MIRT1003121	hsa-miR-3163	CLIP-seq
MIRT1003122	hsa-miR-340	CLIP-seq
MIRT1003123	hsa-miR-4452	CLIP-seq
MIRT1003124	hsa-miR-4729	CLIP-seq
MIRT1003125	hsa-miR-514	CLIP-seq
MIRT1003126	hsa-miR-514b-3p	CLIP-seq
MIRT1003127	hsa-miR-548n	CLIP-seq
MIRT1003128	hsa-miR-548t	CLIP-seq
MIRT1003129	hsa-miR-561	CLIP-seq
MIRT1003130	hsa-miR-579	CLIP-seq
MIRT1003131	hsa-miR-664	CLIP-seq
MIRT1003132	hsa-miR-1184	CLIP-seq
MIRT1003133	hsa-miR-1205	CLIP-seq
MIRT1003134	hsa-miR-23a	CLIP-seq
MIRT1003135	hsa-miR-23b	CLIP-seq
MIRT1003136	hsa-miR-23c	CLIP-seq
MIRT1003137	hsa-miR-3158-5p	CLIP-seq
MIRT1003138	hsa-miR-3164	CLIP-seq
MIRT1003139	hsa-miR-3614-3p	CLIP-seq
MIRT1003140	hsa-miR-4263	CLIP-seq
MIRT1003141	hsa-miR-4299	CLIP-seq
MIRT1003142	hsa-miR-4521	CLIP-seq
MIRT1003143	hsa-miR-4652-3p	CLIP-seq
MIRT1003144	hsa-miR-4686	CLIP-seq
MIRT1003145	hsa-miR-617	CLIP-seq
MIRT1997423	hsa-miR-1275	CLIP-seq
MIRT1997424	hsa-miR-1292	CLIP-seq
MIRT1997425	hsa-miR-149	CLIP-seq
MIRT1997426	hsa-miR-1909	CLIP-seq
MIRT1997427	hsa-miR-214	CLIP-seq
MIRT1997428	hsa-miR-3619-5p	CLIP-seq
MIRT1997429	hsa-miR-4471	CLIP-seq
MIRT1997430	hsa-miR-4651	CLIP-seq
MIRT1997431	hsa-miR-4665-5p	CLIP-seq
MIRT1997432	hsa-miR-608	CLIP-seq
MIRT1997433	hsa-miR-642b	CLIP-seq
MIRT1997434	hsa-miR-761	CLIP-seq
MIRT1997423	hsa-miR-1275	CLIP-seq
MIRT1997426	hsa-miR-1909	CLIP-seq
MIRT1997427	hsa-miR-214	CLIP-seq
MIRT2231091	hsa-miR-2355-5p	CLIP-seq
MIRT2231092	hsa-miR-3157-5p	CLIP-seq
MIRT2231093	hsa-miR-3191	CLIP-seq
MIRT1997428	hsa-miR-3619-5p	CLIP-seq
MIRT2231094	hsa-miR-4267	CLIP-seq
MIRT2231095	hsa-miR-4447	CLIP-seq
MIRT2231096	hsa-miR-4472	CLIP-seq
MIRT2231097	hsa-miR-4525	CLIP-seq
MIRT1997430	hsa-miR-4651	CLIP-seq
MIRT1997431	hsa-miR-4665-5p	CLIP-seq
MIRT2231098	hsa-miR-4691-3p	CLIP-seq
MIRT2231099	hsa-miR-4723-5p	CLIP-seq
MIRT2231100	hsa-miR-4728-5p	CLIP-seq
MIRT1997432	hsa-miR-608	CLIP-seq
MIRT2231101	hsa-miR-625	CLIP-seq
MIRT1997434	hsa-miR-761	CLIP-seq
MIRT2429019	hsa-miR-1284	CLIP-seq
MIRT2429020	hsa-miR-153	CLIP-seq
MIRT2429021	hsa-miR-3144-3p	CLIP-seq
MIRT2429022	hsa-miR-3684	CLIP-seq
MIRT2429023	hsa-miR-4684-5p	CLIP-seq
MIRT2429024	hsa-miR-4768-5p	CLIP-seq
MIRT2429025	hsa-miR-544	CLIP-seq
MIRT2429026	hsa-miR-875-5p	CLIP-seq
MIRT2429019	hsa-miR-1284	CLIP-seq
MIRT2429020	hsa-miR-153	CLIP-seq
MIRT2429021	hsa-miR-3144-3p	CLIP-seq
MIRT2429022	hsa-miR-3684	CLIP-seq
MIRT2429023	hsa-miR-4684-5p	CLIP-seq
MIRT2429024	hsa-miR-4768-5p	CLIP-seq
MIRT2429025	hsa-miR-544	CLIP-seq
MIRT2429026	hsa-miR-875-5p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
TSC22D3	Repression	20018851

Show/Hide all (55)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	11689711
GO:0003676	Function	Nucleic acid binding	EXP	11352721
GO:0003677	Function	DNA binding	IDA	10783894
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	10783894
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	15084259, 15126506, 16114898, 25416956, 36931259
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	16272144, 16964248
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	22972301
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	16964248
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	16272144
GO:0005829	Component	Cytosol	TAS	22972301
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	15126506
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006979	Process	Response to oxidative stress	IDA	36075446
GO:0006979	Process	Response to oxidative stress	IDA	36075446
GO:0007095	Process	Mitotic G2 DNA damage checkpoint signaling	IEA
GO:0007517	Process	Muscle organ development	IEA
GO:0008013	Function	Beta-catenin binding	IDA	15905404
GO:0008013	Function	Beta-catenin binding	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	10783894
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008286	Process	Insulin receptor signaling pathway	IDA	10217147
GO:0014911	Process	Positive regulation of smooth muscle cell migration	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IDA	12761217
GO:0016607	Component	Nuclear speck	IDA
GO:0019899	Function	Enzyme binding	IPI	15126506, 16964248
GO:0030154	Process	Cell differentiation	IEA
GO:0031667	Process	Response to nutrient levels	IEA
GO:0034599	Process	Cellular response to oxidative stress	IDA	15601839, 36075446
GO:0042802	Function	Identical protein binding	IPI	25609649
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	15601839
GO:0043565	Function	Sequence-specific DNA binding	IDA	23332764
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0043565	Function	Sequence-specific DNA binding	IMP	22972301
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	11689711, 15905404
GO:0048863	Process	Stem cell differentiation	IMP	22972301
GO:0051151	Process	Negative regulation of smooth muscle cell differentiation	IDA	16054032
GO:0070317	Process	Negative regulation of G0 to G1 transition	IDA	10783894
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	36075446
GO:0140297	Function	DNA-binding transcription factor binding	IPI	16054032
GO:1990785	Process	Response to water-immersion restraint stress	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990841	Function	Promoter-specific chromatin binding	IEA

MIM	HGNC	e!Ensembl
300033	7139	ENSG00000184481

P98177

Protein name

Forkhead box protein O4 (Fork head domain transcription factor AFX1)

Protein function

Transcription factor involved in the regulation of the insulin signaling pathway. Binds to insulin-response elements (IREs) and can activate transcription of IGFBP1. Down-regulates expression of HIF1A and suppresses hypoxia-induced transcription

PDB

1E17 , 3L2C

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00250	Forkhead	102 → 188	Forkhead domain	Domain
PF16676	FOXO-TAD	463 → 504	Transactivation domain of FOXO protein family	Domain

Tissue specificity

TISSUE SPECIFICITY: Heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Isoform zeta is most abundant in the liver, kidney, and pancreas.

Sequence

MDPGNENSATEAAAIIDLDPDFEPQSRPRSCTWPLPRPEIANQPSEPPEVEPDLGEKVHT
EGRSEPILLPSRLPEPAGGPQPGILGAVTGPRKGGSRRNAWGNQSYAELISQAIESAPEK
RLTLAQIYEWMVRTVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIKVHNEATGKSSWWML
NPEGGKSGKAPRRRAASMDSSSKLLRGRSKAPKKKPSVLPAPPEGATPTSPVGHFAKWSG
SPCSRNREEADMWTTFRPRSSSNASSVSTRLSPLRPESEVLAEEIPASVSSYAGGVPPTL
NEGLELLDGLNLTSSHSLLSRSGLSGFSLQHPGVTGPLHTYSSSLFSPAEGPLSAGEGCF
SSSQALEALLTSDTPPPPADVLMTQVDPILSQAPTLLLLGGLPSSSKLATGVGLCPKPLE
APGPSSLVPTLSMIAPPPVMASAPIPKALGTPVLTPPTEAASQDRMPQDLDLDMYMENLE
CDMDNIISDLMDEGEGLDFNFEPDP

Sequence length

505

Interactions

View interactions

	KEGG		Reactome
	Ras signaling pathway FoxO signaling pathway Shigellosis		AKT phosphorylates targets in the nucleus Constitutive Signaling by AKT1 E17K in Cancer Ub-specific processing proteases Regulation of localization of FOXO transcription factors FOXO-mediated transcription of cell death genes FOXO-mediated transcription of oxidative stress, metabolic and neuronal genes FOXO-mediated transcription of cell cycle genes

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Abnormality of the face	Uncertain significance	rs2521672337	RCV003311595
Clinodactyly	Uncertain significance	rs2521672337	RCV003311595
Intellectual disability	Uncertain significance	rs2147734991	RCV001816028
Macrocephaly	Uncertain significance	rs2521672337	RCV003311595
Moderate intellectual disability	Uncertain significance	rs2521672337	RCV003311595
Short 5th metacarpal	Uncertain significance	rs2521672337	RCV003311595

Show/Hide Text Mining Associations (34)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Atherosclerosis	Associate	32329448
Carcinoma Hepatocellular	Associate	25053419
Carcinoma Non Small Cell Lung	Associate	24935588
Colorectal Neoplasms	Associate	20348951, 23029137
Desmoplastic Small Round Cell Tumor	Associate	25010205
Diabetes Mellitus	Associate	36978091
Diabetic Nephropathies	Inhibit	36978091
Epilepsy	Inhibit	28963932
Glycosuria Renal	Associate	36978091
Hepatitis B	Associate	32228643, 35695580
Hepatitis B Chronic	Associate	35695580
Huntington Disease	Stimulate	28973411
Hypoxia	Inhibit	12761217
Hypoxia	Associate	23696831
Hypoxia Brain	Associate	12761217
Inflammatory Bowel Diseases	Associate	32410873
Kidney Neoplasms	Associate	34907995
Lymphatic Metastasis	Associate	24935588
Lymphoma	Associate	27911272
Lymphoma Large B Cell Diffuse	Associate	27911272
Lymphoma Non Hodgkin	Associate	28963932
Muscle Neoplasms	Associate	22455386
Nasopharyngeal Carcinoma	Associate	30610793
Neoplasm Metastasis	Associate	30610793
Neoplasms	Associate	27911272, 28945225, 28963932, 30610793, 32210275, 33455033, 34816314, 36042628, 36555288
Obesity	Associate	24484739
Prostatic Neoplasms	Associate	35650605
Seizures	Inhibit	28963932
Soft Tissue Injuries	Associate	33455033
Soft Tissue Neoplasms	Associate	33455033
Stomach Neoplasms	Associate	27027443, 30551491
Stomach Neoplasms	Inhibit	33103284
Uterine Cervical Neoplasms	Associate	26715362
Wounds and Injuries	Associate	35705319

FOXO4 (forkhead box O4)