Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4303
Gene name Gene Name - the full gene name approved by the HGNC.	Forkhead box O4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FOXO4
Synonyms (NCBI Gene) Gene synonyms aliases	AFX, AFX1, MLLT7
Chromosome Chromosome number	X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	Xq13.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the O class of winged helix/forkhead transcription factor family. Proteins encoded by this class are regulated by factors involved in growth and differentiation indicating they play a role in these processes. A translocation

Show/Hide all(77)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006698	hsa-miR-499a-5p	Luciferase reporter assay, qRT-PCR, Western blot	21934092
MIRT018590	hsa-miR-335-5p	Microarray	18185580
MIRT039705	hsa-miR-615-3p	CLASH	23622248
MIRT437900	hsa-miR-421	Luciferase reporter assay, Western blot	23707940
MIRT437900	hsa-miR-421	Luciferase reporter assay, Western blot	23707940
MIRT1003121	hsa-miR-3163	CLIP-seq
MIRT1003122	hsa-miR-340	CLIP-seq
MIRT1003123	hsa-miR-4452	CLIP-seq
MIRT1003124	hsa-miR-4729	CLIP-seq
MIRT1003125	hsa-miR-514	CLIP-seq
MIRT1003126	hsa-miR-514b-3p	CLIP-seq
MIRT1003127	hsa-miR-548n	CLIP-seq
MIRT1003128	hsa-miR-548t	CLIP-seq
MIRT1003129	hsa-miR-561	CLIP-seq
MIRT1003130	hsa-miR-579	CLIP-seq
MIRT1003131	hsa-miR-664	CLIP-seq
MIRT1003132	hsa-miR-1184	CLIP-seq
MIRT1003133	hsa-miR-1205	CLIP-seq
MIRT1003134	hsa-miR-23a	CLIP-seq
MIRT1003135	hsa-miR-23b	CLIP-seq
MIRT1003136	hsa-miR-23c	CLIP-seq
MIRT1003137	hsa-miR-3158-5p	CLIP-seq
MIRT1003138	hsa-miR-3164	CLIP-seq
MIRT1003139	hsa-miR-3614-3p	CLIP-seq
MIRT1003140	hsa-miR-4263	CLIP-seq
MIRT1003141	hsa-miR-4299	CLIP-seq
MIRT1003142	hsa-miR-4521	CLIP-seq
MIRT1003143	hsa-miR-4652-3p	CLIP-seq
MIRT1003144	hsa-miR-4686	CLIP-seq
MIRT1003145	hsa-miR-617	CLIP-seq
MIRT1997423	hsa-miR-1275	CLIP-seq
MIRT1997424	hsa-miR-1292	CLIP-seq
MIRT1997425	hsa-miR-149	CLIP-seq
MIRT1997426	hsa-miR-1909	CLIP-seq
MIRT1997427	hsa-miR-214	CLIP-seq
MIRT1997428	hsa-miR-3619-5p	CLIP-seq
MIRT1997429	hsa-miR-4471	CLIP-seq
MIRT1997430	hsa-miR-4651	CLIP-seq
MIRT1997431	hsa-miR-4665-5p	CLIP-seq
MIRT1997432	hsa-miR-608	CLIP-seq
MIRT1997433	hsa-miR-642b	CLIP-seq
MIRT1997434	hsa-miR-761	CLIP-seq
MIRT1997423	hsa-miR-1275	CLIP-seq
MIRT1997426	hsa-miR-1909	CLIP-seq
MIRT1997427	hsa-miR-214	CLIP-seq
MIRT2231091	hsa-miR-2355-5p	CLIP-seq
MIRT2231092	hsa-miR-3157-5p	CLIP-seq
MIRT2231093	hsa-miR-3191	CLIP-seq
MIRT1997428	hsa-miR-3619-5p	CLIP-seq
MIRT2231094	hsa-miR-4267	CLIP-seq
MIRT2231095	hsa-miR-4447	CLIP-seq
MIRT2231096	hsa-miR-4472	CLIP-seq
MIRT2231097	hsa-miR-4525	CLIP-seq
MIRT1997430	hsa-miR-4651	CLIP-seq
MIRT1997431	hsa-miR-4665-5p	CLIP-seq
MIRT2231098	hsa-miR-4691-3p	CLIP-seq
MIRT2231099	hsa-miR-4723-5p	CLIP-seq
MIRT2231100	hsa-miR-4728-5p	CLIP-seq
MIRT1997432	hsa-miR-608	CLIP-seq
MIRT2231101	hsa-miR-625	CLIP-seq
MIRT1997434	hsa-miR-761	CLIP-seq
MIRT2429019	hsa-miR-1284	CLIP-seq
MIRT2429020	hsa-miR-153	CLIP-seq
MIRT2429021	hsa-miR-3144-3p	CLIP-seq
MIRT2429022	hsa-miR-3684	CLIP-seq
MIRT2429023	hsa-miR-4684-5p	CLIP-seq
MIRT2429024	hsa-miR-4768-5p	CLIP-seq
MIRT2429025	hsa-miR-544	CLIP-seq
MIRT2429026	hsa-miR-875-5p	CLIP-seq
MIRT2429019	hsa-miR-1284	CLIP-seq
MIRT2429020	hsa-miR-153	CLIP-seq
MIRT2429021	hsa-miR-3144-3p	CLIP-seq
MIRT2429022	hsa-miR-3684	CLIP-seq
MIRT2429023	hsa-miR-4684-5p	CLIP-seq
MIRT2429024	hsa-miR-4768-5p	CLIP-seq
MIRT2429025	hsa-miR-544	CLIP-seq
MIRT2429026	hsa-miR-875-5p	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
TSC22D3	Repression	20018851

Show/Hide all(42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	11689711
GO:0003677	Function	DNA binding	IDA	10783894
GO:0003700	Function	DNA-binding transcription factor activity	IDA	10783894
GO:0005515	Function	Protein binding	IPI	15084259, 15126506, 16114898, 25416956
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	16272144, 16964248
GO:0005634	Component	Nucleus	TAS	22972301
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	16964248
GO:0005829	Component	Cytosol	IDA	16272144
GO:0005829	Component	Cytosol	TAS	22972301
GO:0006355	Process	Regulation of transcription, DNA-templated	IDA	15126506
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0007050	Process	Cell cycle arrest	IDA	10783894
GO:0007095	Process	Mitotic G2 DNA damage checkpoint	IEA
GO:0007517	Process	Muscle organ development	IEA
GO:0007568	Process	Aging	IEA
GO:0008013	Function	Beta-catenin binding	IDA	15905404
GO:0008134	Function	Transcription factor binding	IPI	16054032
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	10783894
GO:0008286	Process	Insulin receptor signaling pathway	IDA	10217147
GO:0014911	Process	Positive regulation of smooth muscle cell migration	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IDA	12761217
GO:0016579	Process	Protein deubiquitination	TAS
GO:0016607	Component	Nuclear speck	IDA
GO:0019899	Function	Enzyme binding	IPI	15126506, 16964248
GO:0031667	Process	Response to nutrient levels	IEA
GO:0042802	Function	Identical protein binding	IPI	25609649
GO:0043565	Function	Sequence-specific DNA binding	IDA	23332764
GO:0043565	Function	Sequence-specific DNA binding	IMP	22972301
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	11689711, 15905404
GO:0048863	Process	Stem cell differentiation	IMP	22972301
GO:0051151	Process	Negative regulation of smooth muscle cell differentiation	IDA	16054032
GO:0070317	Process	Negative regulation of G0 to G1 transition	IDA	10783894
GO:0071158	Process	Positive regulation of cell cycle arrest	IDA	15905404
GO:1990785	Process	Response to water-immersion restraint stress	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990841	Function	Promoter-specific chromatin binding	IEA

MIM	HGNC	e!Ensembl
300033	7139	ENSG00000184481

Protein

UniProt ID

P98177

Protein name

Forkhead box protein O4 (Fork head domain transcription factor AFX1)

Protein function

Transcription factor involved in the regulation of the insulin signaling pathway. Binds to insulin-response elements (IREs) and can activate transcription of IGFBP1. Down-regulates expression of HIF1A and suppresses hypoxia-induced transcription

PDB

1E17 , 3L2C

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00250	Forkhead	102 → 188	Forkhead domain	Domain
PF16676	FOXO-TAD	463 → 504	Transactivation domain of FOXO protein family	Domain

Tissue specificity

TISSUE SPECIFICITY: Heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Isoform zeta is most abundant in the liver, kidney, and pancreas.

Sequence

MDPGNENSATEAAAIIDLDPDFEPQSRPRSCTWPLPRPEIANQPSEPPEVEPDLGEKVHT
EGRSEPILLPSRLPEPAGGPQPGILGAVTGPRKGGSRRNAWGNQSYAELISQAIESAPEK
RLTLAQIYEWMVRTVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIKVHNEATGKSSWWML
NPEGGKSGKAPRRRAASMDSSSKLLRGRSKAPKKKPSVLPAPPEGATPTSPVGHFAKWSG
SPCSRNREEADMWTTFRPRSSSNASSVSTRLSPLRPESEVLAEEIPASVSSYAGGVPPTL
NEGLELLDGLNLTSSHSLLSRSGLSGFSLQHPGVTGPLHTYSSSLFSPAEGPLSAGEGCF
SSSQALEALLTSDTPPPPADVLMTQVDPILSQAPTLLLLGGLPSSSKLATGVGLCPKPLE
APGPSSLVPTLSMIAPPPVMASAPIPKALGTPVLTPPTEAASQDRMPQDLDLDMYMENLE
CDMDNIISDLMDEGEGLDFNFEPDP

Sequence length

505

Interactions

View interactions

	KEGG		Reactome
	Ras signaling pathway FoxO signaling pathway Shigellosis		AKT phosphorylates targets in the nucleus Constitutive Signaling by AKT1 E17K in Cancer Ub-specific processing proteases Regulation of localization of FOXO transcription factors FOXO-mediated transcription of cell death genes FOXO-mediated transcription of oxidative stress, metabolic and neuronal genes FOXO-mediated transcription of cell cycle genes

FOXO4 (forkhead box O4)