Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4300
Gene name Gene Name - the full gene name approved by the HGNC.
MLLT3 super elongation complex subunit
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MLLT3
Synonyms (NCBI Gene) Gene synonyms aliases
AF9, YEATS3
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9p21.3
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022911 hsa-miR-124-3p Microarray 18668037
MIRT508970 hsa-miR-1277-5p PAR-CLIP 20371350
MIRT535872 hsa-miR-5692b PAR-CLIP 20371350
MIRT535871 hsa-miR-5692c PAR-CLIP 20371350
MIRT508975 hsa-miR-410-3p PAR-CLIP 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003677 Function DNA binding IEA
GO:0003682 Function Chromatin binding IDA 25417107, 27105114
GO:0005515 Function Protein binding IPI 16189514, 20153263, 20203130, 21729782, 23145062, 23260655, 26496610, 28514442, 32296183
GO:0005634 Component Nucleus TAS 8506309
GO:0005654 Component Nucleoplasm IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
159558 7136 ENSG00000171843
Protein
UniProt ID P42568
Protein name Protein AF-9 (ALL1-fused gene from chromosome 9 protein) (Myeloid/lymphoid or mixed-lineage leukemia translocated to chromosome 3 protein) (YEATS domain-containing protein 3)
Protein function Chromatin reader component of the super elongation complex (SEC), a complex required to increase the catalytic rate of RNA polymerase II transcription by suppressing transient pausing by the polymerase at multiple sites along the DNA (PubMed:201
PDB 2LM0 , 2MV7 , 2N4Q , 2NDF , 2NDG , 4TMP , 5HJB , 5HJD , 5YYF , 6B7G , 6L5Z , 6LS6 , 6MIL , 6MIM , 7EIC , 7EID , 7VKG , 7VKH , 8PJ7 , 8TLV , 8TLW , 8TLX , 9ARO , 9ARR
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03366 YEATS 29 110 YEATS family Domain
PF17793 AHD 503 563 ANC1 homology domain (AHD) Domain
Tissue specificity TISSUE SPECIFICITY: Enriched in undifferentiated hematopoietic stem cells in fetal liver, cord blood and bone marrow. {ECO:0000269|PubMed:31776511}.
Sequence
MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFP
RPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPRKVRFDYDLFLHLEG
HPPVNHLRCE
KLTFNNPTEDFRRKLLKAGGDPNRSIHTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS
SSSSSSSSSSTSFSKPHKLMKEHKEKPSKDSREHKSAFKEPSRDHNKSSKESSKKPKENK
PLKEEKIVPKMAFKEPKPMSKEPKPDSNLLTITSGQDKKAPSKRPPISDSEELSAKKRKK
SSSEALFKSFSSAPPLILTCSADKKQIKDKSHVKMGKVKIESETSEKKKSTLPPFDDIVD
PNDSDVEENISSKSDSEQPSPASSSSSSSSSFTPSQTRQQGPLRSIMKDLHSDDNEEESD
EVEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSSASSPLHHEPPPPLLKTNNNQILE
VKSPIKQSKSDKQIKNGECDKAYLDELVELHRRLMTLRERHILQQIVNLIEETGHFHITN
TTFDFDLCSLDKTTVRKLQSYLE
TSGTS
Sequence length 568
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Viral life cycle - HIV-1
Transcriptional misregulation in cancer
  Formation of RNA Pol II elongation complex
RNA Polymerase II Pre-transcription Events
RNA Polymerase II Transcription Elongation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Asthma Asthma 26083242 ClinVar, GWAS
Diabetes Diabetes GWAS
Atrial Fibrillation Atrial Fibrillation GWAS
Gout Gout GWAS
Associations from Text Mining
Disease Name Relationship Type References
Chromosome 5q Deletion Syndrome Associate 30514321
Chromosome Aberrations Associate 8506309
Death Associate 33668731
Genetic Diseases Inborn Associate 33419897
Hyperplasia Stimulate 20805992
Hypomagnesemia primary Associate 33668731
Idiopathic Pulmonary Fibrosis Associate 37266442
Leukemia Associate 17726105, 17875318, 20656931, 29164580, 36585787
Leukemia Biphenotypic Acute Associate 22174154, 22615413, 24769646, 29477140, 29649994, 30514321, 30646906, 35119307
Leukemia Megakaryoblastic Acute Associate 26215111