Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	43
Gene name Gene Name - the full gene name approved by the HGNC.	Acetylcholinesterase (Yt blood group)
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ACHE
Synonyms (NCBI Gene) Gene synonyms aliases	ACEE, ARACHE, N-ACHE, YT
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7q22.1
Summary Summary of gene provided in NCBI Entrez Gene.	Acetylcholinesterase hydrolyzes the neurotransmitter, acetylcholine at neuromuscular junctions and brain cholinergic synapses, and thus terminates signal transmission. It is also found on the red blood cell membranes, where it constitutes the Yt blood gro

Show/Hide all(39)

miRTarBase ID	miRNA	Experiments	Reference
MIRT438683	hsa-miR-212-3p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	23974008
MIRT438683	hsa-miR-212-3p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	23974008
MIRT762670	hsa-miR-186	CLIP-seq
MIRT762671	hsa-miR-193a-3p	CLIP-seq
MIRT762672	hsa-miR-193b	CLIP-seq
MIRT762673	hsa-miR-200b	CLIP-seq
MIRT762674	hsa-miR-200c	CLIP-seq
MIRT762675	hsa-miR-2355-5p	CLIP-seq
MIRT762676	hsa-miR-3119	CLIP-seq
MIRT762677	hsa-miR-3163	CLIP-seq
MIRT762678	hsa-miR-340	CLIP-seq
MIRT762679	hsa-miR-4286	CLIP-seq
MIRT762680	hsa-miR-429	CLIP-seq
MIRT762681	hsa-miR-4775	CLIP-seq
MIRT762682	hsa-miR-587	CLIP-seq
MIRT762683	hsa-miR-590-3p	CLIP-seq
MIRT762684	hsa-miR-892b	CLIP-seq
MIRT1924832	hsa-miR-1247	CLIP-seq
MIRT1924833	hsa-miR-3121-3p	CLIP-seq
MIRT1924834	hsa-miR-3156-3p	CLIP-seq
MIRT1924835	hsa-miR-3679-3p	CLIP-seq
MIRT1924836	hsa-miR-4301	CLIP-seq
MIRT1924837	hsa-miR-4324	CLIP-seq
MIRT1924838	hsa-miR-532-3p	CLIP-seq
MIRT2166042	hsa-miR-185	CLIP-seq
MIRT2166043	hsa-miR-214	CLIP-seq
MIRT762675	hsa-miR-2355-5p	CLIP-seq
MIRT2166044	hsa-miR-3619-5p	CLIP-seq
MIRT762679	hsa-miR-4286	CLIP-seq
MIRT2166045	hsa-miR-4306	CLIP-seq
MIRT1924837	hsa-miR-4324	CLIP-seq
MIRT2166046	hsa-miR-4428	CLIP-seq
MIRT2166047	hsa-miR-4434	CLIP-seq
MIRT2166048	hsa-miR-4476	CLIP-seq
MIRT2166049	hsa-miR-4516	CLIP-seq
MIRT2166050	hsa-miR-4533	CLIP-seq
MIRT2166051	hsa-miR-4644	CLIP-seq
MIRT2166052	hsa-miR-4743	CLIP-seq
MIRT2166053	hsa-miR-761	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
EGR1	Unknown	7559515
TFAP2A	Repression	7559515

Show/Hide all(57)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001507	Process	Acetylcholine catabolic process in synaptic cleft	NAS	1517212
GO:0001540	Function	Amyloid-beta binding	TAS	11283752
GO:0001919	Process	Regulation of receptor recycling	IEA
GO:0002076	Process	Osteoblast development	IEP	15454088
GO:0003990	Function	Acetylcholinesterase activity	IBA
GO:0003990	Function	Acetylcholinesterase activity	IDA	1517212
GO:0003990	Function	Acetylcholinesterase activity	IEA
GO:0003990	Function	Acetylcholinesterase activity	IMP	1517212
GO:0003990	Function	Acetylcholinesterase activity	TAS
GO:0004104	Function	Cholinesterase activity	IDA	1517212
GO:0004104	Function	Cholinesterase activity	IEA
GO:0005515	Function	Protein binding	IPI	10800960, 15526038, 18194455
GO:0005518	Function	Collagen binding	IDA	12524166
GO:0005576	Component	Extracellular region	IDA	1517212
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	11283752
GO:0005604	Component	Basement membrane	IEA
GO:0005604	Component	Basement membrane	NAS	16289501
GO:0005615	Component	Extracellular space	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005794	Component	Golgi apparatus	IDA	15454088
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006581	Process	Acetylcholine catabolic process	IBA
GO:0006581	Process	Acetylcholine catabolic process	IDA	1517212
GO:0006581	Process	Acetylcholine catabolic process	IEA
GO:0006581	Process	Acetylcholine catabolic process	TAS
GO:0007155	Process	Cell adhesion	IDA	15454088
GO:0007399	Process	Nervous system development	TAS	11283752
GO:0007416	Process	Synapse assembly	TAS	11283752
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IDA	16262697
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IDA	1517212
GO:0016787	Function	Hydrolase activity	IEA
GO:0017171	Function	Serine hydrolase activity	IDA	3954986
GO:0031594	Component	Neuromuscular junction	IEA
GO:0031623	Process	Receptor internalization	IEA
GO:0032223	Process	Negative regulation of synaptic transmission, cholinergic	IC	1517212
GO:0042166	Function	Acetylcholine binding	IDA	8349597
GO:0042166	Function	Acetylcholine binding	NAS	1517212
GO:0042802	Function	Identical protein binding	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	12524166
GO:0042982	Process	Amyloid precursor protein metabolic process	TAS	12769797
GO:0043083	Component	Synaptic cleft	IEA
GO:0043236	Function	Laminin binding	IDA	12524166
GO:0043236	Function	Laminin binding	IEA
GO:0045202	Component	Synapse	IDA	8460160
GO:0045202	Component	Synapse	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	14766237
GO:0050714	Process	Positive regulation of protein secretion	TAS	11283752
GO:0052689	Function	Carboxylic ester hydrolase activity	IEA
GO:0060041	Process	Retina development in camera-type eye	IEA
GO:0095500	Process	Acetylcholine receptor signaling pathway	IEA
GO:0098552	Component	Side of membrane	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	17038428

MIM	HGNC	e!Ensembl
100740	108	ENSG00000087085

Protein

UniProt ID

P22303

Protein name

Acetylcholinesterase (AChE) (EC 3.1.1.7)

Protein function

Hydrolyzes rapidly the acetylcholine neurotransmitter released into the synaptic cleft allowing to terminate the signal transduction at the neuromuscular junction. Role in neuronal apoptosis. {ECO:0000269|PubMed:11985878, ECO:0000269|PubMed:1517

PDB

1B41 , 1F8U , 1VZJ , 2X8B , 3LII , 4BDT , 4EY4 , 4EY5 , 4EY6 , 4EY7 , 4EY8 , 4M0E , 4M0F , 4PQE , 5FOQ , 5FPQ , 5HF5 , 5HF6 , 5HF8 , 5HF9 , 5HFA , 5HQ3 , 6CQT , 6CQU , 6CQV , 6CQW , 6CQX , 6CQY , 6CQZ , 6F25 , 6NEA , 6NTG , 6NTH , 6NTK , 6NTL , 6NTM , 6NTN , 6NTO , 6O4W , 6O4X , 6O50 , 6O52 , 6O5R , 6O5S , 6O5V , 6O66 , 6O69 , 6U34 , 6U37 , 6U3P , 6WUV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00135	COesterase	37 → 563	Carboxylesterase family	Domain
PF08674	AChE_tetra	578 → 613	Acetylcholinesterase tetramerisation domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform H is highly expressed in erythrocytes. {ECO:0000269|PubMed:2714437}.

Sequence

MRPPQCLLHTPSLASPLLLLLLWLLGGGVGAEGREDAELLVTVRGGRLRGIRLKTPGGPV
SAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFEGTEMWNPN
RELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSM
NYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASV
GMHLLSPPSRGLFHRAVLQSGAPNGPWATVGMGEARRRATQLAHLVGCPPGGTGGNDTEL
VACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDFHGLQVLVG
VVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPE
DPARLREALSDVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGY
EIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWANFARTGDPNEPRDPKAPQWPPYTAGAQQ
YVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKN
QFDHYSKQDRCSDL

Sequence length

614

Interactions

View interactions

	KEGG		Reactome
	Glycerophospholipid metabolism Cholinergic synapse		Neurotransmitter clearance Synthesis of PC Synthesis, secretion, and deacylation of Ghrelin

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Diabetes	Type 2 diabetes	N/A	N/A	GWAS

Show/Hide Text Mining Associations (70)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
AA amyloidosis	Associate	17653279
Acute cholinergic dysautonomia	Associate	27258420
Adenoma	Associate	33423702
Alopecia	Associate	35181715
Alzheimer Disease	Associate	15009666, 17096857, 17653279, 18769671, 19384276, 20221449, 22351782, 24318838, 24359497, 26325402, 28005991, 34714861, 34831318, 36006974
Alzheimer Disease	Inhibit	21691765, 24312390, 27258420, 30914707
Anxiety	Associate	15060281
Aphasia Primary Progressive	Associate	28018854
Autism Spectrum Disorder	Associate	31838722
Autistic Disorder	Associate	18555979
Breast Neoplasms	Associate	20193849, 23063927, 28077796
Carcinogenesis	Associate	20193849
Carcinoma Hepatocellular	Inhibit	25869328
Carcinoma Non Small Cell Lung	Associate	37842037
Carcinoma Renal Cell	Stimulate	20883446
Carcinoma Renal Cell	Associate	33221754
Colorectal Neoplasms	Associate	16909200
Congenital Abnormalities	Associate	2453115
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	20227402
COVID 19	Associate	36928077
Delirium	Inhibit	21576115
Dementia	Associate	31823156
Dementia	Inhibit	39608999
Diabetes Mellitus	Associate	17096857
Diabetes Mellitus Type 2	Associate	17096857
Diffuse Neurofibrillary Tangles with Calcification	Stimulate	24318838
Drug Related Side Effects and Adverse Reactions	Associate	33145964
Emergence Delirium	Associate	32988381
Endplate Acetylcholinesterase Deficiency	Associate	9758617
Fecal Incontinence	Associate	29566057
Fibrocartilaginous embolism	Associate	35776042
Frontotemporal Dementia	Stimulate	28018854
Giant Cell Arteritis	Associate	31162030
Glioblastoma	Associate	15153340
Glioblastoma	Inhibit	40651751
Head and Neck Neoplasms	Associate	25956553
Hemoglobinuria Paroxysmal	Associate	1688724, 9516159
Ichthyosis Bullosa of Siemens	Associate	34859100
Idiopathic Pulmonary Fibrosis	Associate	33402146
Immunologic Deficiency Syndromes	Associate	2473800
Infertility Male	Associate	37027384
Inflammation	Associate	20464061, 29358722, 31162030, 35776042, 37027384
Insulin Resistance	Associate	17096857
Kidney Neoplasms	Associate	20883446
Leukemia	Associate	2734315
Liver Cirrhosis	Associate	23028565
Liver Neoplasms	Inhibit	25869328
Melanoma Cutaneous Malignant	Associate	40651751
Migraine Disorders	Inhibit	28018854
Multiple pterygium syndrome	Associate	24038971
Multiple Sclerosis	Associate	21691765, 27916909, 29358722
Myasthenia Gravis	Associate	18545673
Myasthenic Syndromes Congenital	Associate	19251977, 22759693, 25557462, 7814634
Neoplasms	Associate	16909200, 20193849, 25956553, 28076321, 40651751
Neoplasms	Inhibit	25869328
Neurobehavioral Manifestations	Associate	28005991
Neuromuscular Junction Diseases	Associate	9758617
Olivopontocerebellar Atrophies	Inhibit	3164041
Pancreatic Neoplasms	Stimulate	40651751
Parkinson Disease	Associate	3164041, 34659588, 36006974
Plaque Amyloid	Stimulate	24318838
Plaque Amyloid	Associate	26293308
Purpura Thrombocytopenic Idiopathic	Associate	9160669
Salter Harris Fractures	Inhibit	7814634
Sleep Apnea Obstructive	Inhibit	32380702
Spinal Cord Injuries	Associate	37803037
Squamous Cell Carcinoma of Head and Neck	Associate	25956553
Stroke	Associate	20464061
Uveal melanoma	Associate	40651751
Vitiligo	Associate	35411132

ACHE (acetylcholinesterase (Yt blood group))