Gene Gene information from NCBI Gene database.
Entrez ID 4296
Gene name Mitogen-activated protein kinase kinase kinase 11
Gene symbol MAP3K11
Synonyms (NCBI Gene)
MEKK11MLK-3MLK3PTK1SPRK
Chromosome 11
Chromosome location 11q13.1
Summary The protein encoded by this gene is a member of the serine/threonine kinase family. This kinase contains a SH3 domain and a leucine zipper-basic motif. This kinase preferentially activates MAPK8/JNK kinase, and functions as a positive regulator of JNK sig
miRNA miRNA information provided by mirtarbase database.
194
miRTarBase ID miRNA Experiments Reference
MIRT005873 hsa-miR-199a-5p Luciferase reporter assayqRT-PCRWestern blot 21048306
MIRT005873 hsa-miR-199a-5p Luciferase reporter assayqRT-PCRWestern blot 21048306
MIRT053660 hsa-miR-145-5p Microarray 22942087
MIRT438462 hsa-miR-138-5p Luciferase reporter assay 24211202
MIRT438462 hsa-miR-138-5p Luciferase reporter assay 24211202
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
46
GO ID Ontology Definition Evidence Reference
GO:0000165 Process MAPK cascade IMP 15258589
GO:0000166 Function Nucleotide binding IEA
GO:0004672 Function Protein kinase activity IEA
GO:0004672 Function Protein kinase activity TAS 8183572, 10799501
GO:0004674 Function Protein serine/threonine kinase activity IDA 8195146
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
600050 6850 ENSG00000173327
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q16584
Protein name Mitogen-activated protein kinase kinase kinase 11 (EC 2.7.11.25) (Mixed lineage kinase 3) (Src-homology 3 domain-containing proline-rich kinase)
Protein function Activates the JUN N-terminal pathway. Required for serum-stimulated cell proliferation and for mitogen and cytokine activation of MAPK14 (p38), MAPK3 (ERK) and MAPK8 (JNK1) through phosphorylation and activation of MAP2K4/MKK4 and MAP2K7/MKK7. P
PDB 5K26 , 5K28 , 6AQB , 6CQ7
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14604 SH3_9 48 101 Variant SH3 domain Domain
PF07714 PK_Tyr_Ser-Thr 117 376 Protein tyrosine and serine/threonine kinase Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in a wide variety of normal and neoplastic tissues including fetal lung, liver, heart and kidney, and adult lung, liver, heart, kidney, placenta, skeletal muscle, pancreas and brain. {ECO:0000269|PubMed:8183572, ECO:0000269|P
Sequence
MEPLKSLFLKSPLGSWNGSGSGGGGGGGGGRPEGSPKAAGYANPVWTALFDYEPSGQDEL
ALRKGDRVEVLSRDAAISGDEGWWAGQVGGQVGIFPSNYVS
RGGGPPPCEVASFQELRLE
EVIGIGGFGKVYRGSWRGELVAVKAARQDPDEDISVTAESVRQEARLFAMLAHPNIIALK
AVCLEEPNLCLVMEYAAGGPLSRALAGRRVPPHVLVNWAVQIARGMHYLHCEALVPVIHR
DLKSNNILLLQPIESDDMEHKTLKITDFGLAREWHKTTQMSAAGTYAWMAPEVIKASTFS
KGSDVWSFGVLLWELLTGEVPYRGIDCLAVAYGVAVNKLTLPIPSTCPEPFAQLMADCWA
QDPHRRPDFASILQQL
EALEAQVLREMPRDSFHSMQEGWKREIQGLFDELRAKEKELLSR
EEELTRAAREQRSQAEQLRRREHLLAQWELEVFERELTLLLQQVDRERPHVRRRRGTFKR
SKLRARDGGERISMPLDFKHRITVQASPGLDRRRNVFEVGPGDSPTFPRFRAIQLEPAEP
GQAWGRQSPRRLEDSSNGERRACWAWGPSSPKPGEAQNGRRRSRMDEATWYLDSDDSSPL
GSPSTPPALNGNPPRPSLEPEEPKRPVPAERGSSSGTPKLIQRALLRGTALLASLGLGRD
LQPPGGPGRERGESPTTPPTPTPAPCPTEPPPSPLICFSLKTPDSPPTPAPLLLDLGIPV
GQRSAKSPRREEEPRGGTVSPPPGTSRSAPGTPGTPRSPPLGLISRPRPSPLRSRIDPWS
FVSAGPRPSPLPSPQPAPRRAPWTLFPDSDPFWDSPPANPFQGGPQDCRAQTKDMGAQAP
WVPEAGP
Sequence length 847
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  MAPK signaling pathway
Non-alcoholic fatty liver disease
  RAF activation
Signaling by moderate kinase activity BRAF mutants
Paradoxical activation of RAF signaling by kinase inactive BRAF
Signaling downstream of RAS mutants
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Moyamoya angiopathy Likely pathogenic rs746476599 RCV004704487
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Lung cancer Uncertain significance rs1218144252 RCV005927287
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Arthritis Rheumatoid Associate 36969166
Asthma Associate 28479334
Breast Neoplasms Associate 15001580, 26152725, 28388540
Carcinogenesis Associate 19567454, 24912674
Carcinoma Hepatocellular Associate 32214367
Colorectal Neoplasms Associate 24628919, 29084209
Coronary Artery Disease Associate 35246263
Encephalitis Herpes Simplex Associate 21880738
Esophageal Neoplasms Associate 26717044
Gastrointestinal Neoplasms Associate 24628919