Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4294
Gene name Gene Name - the full gene name approved by the HGNC.	Mitogen-activated protein kinase kinase kinase 10
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MAP3K10
Synonyms (NCBI Gene) Gene synonyms aliases	MEKK10, MLK2, MST
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the serine/threonine kinase family. This kinase has been shown to activate MAPK8/JNK and MKK4/SEK1, and this kinase itself can be phoshorylated, and thus activated by JNK kinases. This kinase functions prefe

Show/Hide all(46)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005545	hsa-miR-181b-5p	qRT-PCR, Western blot	20596961
MIRT005545	hsa-miR-181b-5p	qRT-PCR, Western blot	20596961
MIRT007103	hsa-miR-155-5p	Luciferase reporter assay	23189122
MIRT007103	hsa-miR-155-5p	Luciferase reporter assay	23189122
MIRT007103	hsa-miR-155-5p	Reporter assay;Other	20584899
MIRT042327	hsa-miR-484	CLASH	23622248
MIRT053691	hsa-miR-181a-5p	Microarray	22942087
MIRT007103	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT007103	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT732536	hsa-miR-146b-3p	Microarray, qRT-PCR, Western blotting	33995647
MIRT2036441	hsa-miR-1207-5p	CLIP-seq
MIRT2036442	hsa-miR-1915	CLIP-seq
MIRT2036443	hsa-miR-361-3p	CLIP-seq
MIRT2036444	hsa-miR-3918	CLIP-seq
MIRT2036445	hsa-miR-4492	CLIP-seq
MIRT2036446	hsa-miR-4498	CLIP-seq
MIRT2036447	hsa-miR-4505	CLIP-seq
MIRT2036448	hsa-miR-4512	CLIP-seq
MIRT2036449	hsa-miR-4685-5p	CLIP-seq
MIRT2036450	hsa-miR-4722-3p	CLIP-seq
MIRT2036451	hsa-miR-4731-5p	CLIP-seq
MIRT2036452	hsa-miR-4763-3p	CLIP-seq
MIRT2036453	hsa-miR-4793-5p	CLIP-seq
MIRT2036454	hsa-miR-486-3p	CLIP-seq
MIRT2036455	hsa-miR-762	CLIP-seq
MIRT2036441	hsa-miR-1207-5p	CLIP-seq
MIRT2266701	hsa-miR-1224-3p	CLIP-seq
MIRT2036442	hsa-miR-1915	CLIP-seq
MIRT2036443	hsa-miR-361-3p	CLIP-seq
MIRT2036444	hsa-miR-3918	CLIP-seq
MIRT2036448	hsa-miR-4512	CLIP-seq
MIRT2036449	hsa-miR-4685-5p	CLIP-seq
MIRT2036450	hsa-miR-4722-3p	CLIP-seq
MIRT2036452	hsa-miR-4763-3p	CLIP-seq
MIRT2036454	hsa-miR-486-3p	CLIP-seq
MIRT2266701	hsa-miR-1224-3p	CLIP-seq
MIRT2566311	hsa-miR-1908	CLIP-seq
MIRT2566312	hsa-miR-3622b-5p	CLIP-seq
MIRT2566313	hsa-miR-3688-5p	CLIP-seq
MIRT2566314	hsa-miR-4474-3p	CLIP-seq
MIRT2036445	hsa-miR-4492	CLIP-seq
MIRT2036446	hsa-miR-4498	CLIP-seq
MIRT2036447	hsa-miR-4505	CLIP-seq
MIRT2036451	hsa-miR-4731-5p	CLIP-seq
MIRT2566315	hsa-miR-663	CLIP-seq
MIRT2036455	hsa-miR-762	CLIP-seq

Show/Hide all(33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003714	Function	Transcription corepressor activity	ISS
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	TAS	8536694, 10801775
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	19801649
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004706	Function	JUN kinase kinase kinase activity	IBA
GO:0004706	Function	JUN kinase kinase kinase activity	ISS	8195146
GO:0004709	Function	MAP kinase kinase kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	20936779, 32707033
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	18455992
GO:0006915	Process	Apoptotic process	TAS	10801775
GO:0007165	Process	Signal transduction	IBA
GO:0007165	Process	Signal transduction	TAS	10801775
GO:0007224	Process	Smoothened signaling pathway	IMP	18455992
GO:0007254	Process	JNK cascade	TAS	10801775
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0018105	Process	Peptidyl-serine phosphorylation	IDA	19801649
GO:0018107	Process	Peptidyl-threonine phosphorylation	IDA	19801649
GO:0042803	Function	Protein homodimerization activity	ISS	8195146
GO:0043065	Process	Positive regulation of apoptotic process	IBA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043425	Function	BHLH transcription factor binding	IPI	19801649
GO:0043433	Process	Negative regulation of DNA-binding transcription factor activity	IMP	19801649
GO:0043507	Process	Positive regulation of JUN kinase activity	IMP	17584736
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	19801649
GO:0045892	Process	Negative regulation of DNA-templated transcription	ISS
GO:0046330	Process	Positive regulation of JNK cascade	IMP	17584736
GO:0046777	Process	Protein autophosphorylation	ISS	8195146
GO:0106310	Function	Protein serine kinase activity	IEA

MIM	HGNC	e!Ensembl
600137	6849	ENSG00000130758

Protein

UniProt ID

Q02779

Protein name

Mitogen-activated protein kinase kinase kinase 10 (EC 2.7.11.25) (Mixed lineage kinase 2) (Protein kinase MST)

Protein function

Activates the JUN N-terminal pathway.

PDB

2RF0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14604	SH3_9	23 → 77	Variant SH3 domain	Domain
PF07714	PK_Tyr_Ser-Thr	98 → 357	Protein tyrosine and serine/threonine kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain and skeletal muscle.

Sequence

MEEEEGAVAKEWGTTPAGPVWTAVFDYEAAGDEELTLRRGDRVQVLSQDCAVSGDEGWWT
GQLPSGRVGVFPSNYVAPGAPAAPAGLQLPQEIPFHELQLEEIIGVGGFGKVYRALWRGE
EVAVKAARLDPEKDPAVTAEQVCQEARLFGALQHPNIIALRGACLNPPHLCLVMEYARGG
ALSRVLAGRRVPPHVLVNWAVQVARGMNYLHNDAPVPIIHRDLKSINILILEAIENHNLA
DTVLKITDFGLAREWHKTTKMSAAGTYAWMAPEVIRLSLFSKSSDVWSFGVLLWELLTGE
VPYREIDALAVAYGVAMNKLTLPIPSTCPEPFARLLEECWDPDPHGRPDFGSILKRLEVI
EQSALFQMPLESFHSLQEDWKLEIQHMFDDLRTKEKELRSREEELLRAAQEQRFQEEQLR
RREQELAEREMDIVERELHLLMCQLSQEKPRVRKRKGNFKRSRLLKLREGGSHISLPSGF
EHKITVQASPTLDKRKGSDGASPPASPSIIPRLRAIRLTPVDCGGSSSGSSSGGSGTWSR
GGPPKKEELVGGKKKGRTWGPSSTLQKERVGGEERLKGLGEGSKQWSSSAPNLGKSPKHT
PIAPGFASLNEMEEFAEAEDGGSSVPPSPYSTPSYLSVPLPAEPSPGARAPWEPTPSAPP
ARWGHGARRRCDLALLGCATLLGAVGLGADVAEARAADGEEQRRWLDGLFFPRAGRFPRG
LSPPARPHGRREDVGPGLGLAPSATLVSLSSVSDCNSTRSLLRSDSDEAAPAAPSPPPSP
PAPTPTPSPSTNPLVDLELESFKKDPRQSLTPTHVTAACAVSRGHRRTPSDGALGQRGPP
EPAGHGPGPRDLLDFPRLPDPQALFPARRRPPEFPGRPTTLTFAPRPRPAASRPRLDPWK
LVSFGRTLTISPPSRPDTPESPGPPSVQPTLLDMDMEGQNQDSTVPLCGAHGSH

Sequence length

954

Interactions

View interactions

	KEGG
	MAPK signaling pathway Huntington disease Pathways of neurodegeneration - multiple diseases

MAP3K10 (mitogen-activated protein kinase kinase kinase 10)