Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4294
Gene name	Mitogen-activated protein kinase kinase kinase 10
Gene symbol	MAP3K10
Synonyms (NCBI Gene)	MEKK10MLK2MST
Chromosome	19
Chromosome location	19q13.2
Summary	The protein encoded by this gene is a member of the serine/threonine kinase family. This kinase has been shown to activate MAPK8/JNK and MKK4/SEK1, and this kinase itself can be phoshorylated, and thus activated by JNK kinases. This kinase functions prefe

Show/Hide all (46)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005545	hsa-miR-181b-5p	qRT-PCRWestern blot	20596961
MIRT005545	hsa-miR-181b-5p	qRT-PCRWestern blot	20596961
MIRT007103	hsa-miR-155-5p	Luciferase reporter assay	23189122
MIRT007103	hsa-miR-155-5p	Luciferase reporter assay	23189122
MIRT007103	hsa-miR-155-5p	Reporter assay;Other	20584899
MIRT042327	hsa-miR-484	CLASH	23622248
MIRT053691	hsa-miR-181a-5p	Microarray	22942087
MIRT007103	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT007103	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT732536	hsa-miR-146b-3p	MicroarrayqRT-PCRWestern blotting	33995647
MIRT2036441	hsa-miR-1207-5p	CLIP-seq
MIRT2036442	hsa-miR-1915	CLIP-seq
MIRT2036443	hsa-miR-361-3p	CLIP-seq
MIRT2036444	hsa-miR-3918	CLIP-seq
MIRT2036445	hsa-miR-4492	CLIP-seq
MIRT2036446	hsa-miR-4498	CLIP-seq
MIRT2036447	hsa-miR-4505	CLIP-seq
MIRT2036448	hsa-miR-4512	CLIP-seq
MIRT2036449	hsa-miR-4685-5p	CLIP-seq
MIRT2036450	hsa-miR-4722-3p	CLIP-seq
MIRT2036451	hsa-miR-4731-5p	CLIP-seq
MIRT2036452	hsa-miR-4763-3p	CLIP-seq
MIRT2036453	hsa-miR-4793-5p	CLIP-seq
MIRT2036454	hsa-miR-486-3p	CLIP-seq
MIRT2036455	hsa-miR-762	CLIP-seq
MIRT2036441	hsa-miR-1207-5p	CLIP-seq
MIRT2266701	hsa-miR-1224-3p	CLIP-seq
MIRT2036442	hsa-miR-1915	CLIP-seq
MIRT2036443	hsa-miR-361-3p	CLIP-seq
MIRT2036444	hsa-miR-3918	CLIP-seq
MIRT2036448	hsa-miR-4512	CLIP-seq
MIRT2036449	hsa-miR-4685-5p	CLIP-seq
MIRT2036450	hsa-miR-4722-3p	CLIP-seq
MIRT2036452	hsa-miR-4763-3p	CLIP-seq
MIRT2036454	hsa-miR-486-3p	CLIP-seq
MIRT2266701	hsa-miR-1224-3p	CLIP-seq
MIRT2566311	hsa-miR-1908	CLIP-seq
MIRT2566312	hsa-miR-3622b-5p	CLIP-seq
MIRT2566313	hsa-miR-3688-5p	CLIP-seq
MIRT2566314	hsa-miR-4474-3p	CLIP-seq
MIRT2036445	hsa-miR-4492	CLIP-seq
MIRT2036446	hsa-miR-4498	CLIP-seq
MIRT2036447	hsa-miR-4505	CLIP-seq
MIRT2036451	hsa-miR-4731-5p	CLIP-seq
MIRT2566315	hsa-miR-663	CLIP-seq
MIRT2036455	hsa-miR-762	CLIP-seq

Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003714	Function	Transcription corepressor activity	ISS
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	TAS	8536694, 10801775
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	19801649
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004706	Function	JUN kinase kinase kinase activity	IBA
GO:0004706	Function	JUN kinase kinase kinase activity	ISS	8195146
GO:0004709	Function	MAP kinase kinase kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	20936779, 32707033
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	18455992
GO:0006915	Process	Apoptotic process	TAS	10801775
GO:0007165	Process	Signal transduction	IBA
GO:0007165	Process	Signal transduction	TAS	10801775
GO:0007224	Process	Smoothened signaling pathway	IMP	18455992
GO:0007254	Process	JNK cascade	TAS	10801775
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0018105	Process	Peptidyl-serine phosphorylation	IDA	19801649
GO:0018107	Process	Peptidyl-threonine phosphorylation	IDA	19801649
GO:0042803	Function	Protein homodimerization activity	ISS	8195146
GO:0043065	Process	Positive regulation of apoptotic process	IBA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043425	Function	BHLH transcription factor binding	IPI	19801649
GO:0043433	Process	Negative regulation of DNA-binding transcription factor activity	IMP	19801649
GO:0043507	Process	Positive regulation of JUN kinase activity	IMP	17584736
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	19801649
GO:0045892	Process	Negative regulation of DNA-templated transcription	ISS
GO:0046330	Process	Positive regulation of JNK cascade	IMP	17584736
GO:0046777	Process	Protein autophosphorylation	ISS	8195146
GO:0106310	Function	Protein serine kinase activity	IEA

MIM	HGNC	e!Ensembl
600137	6849	ENSG00000130758

Q02779

Protein name

Mitogen-activated protein kinase kinase kinase 10 (EC 2.7.11.25) (Mixed lineage kinase 2) (Protein kinase MST)

Protein function

Activates the JUN N-terminal pathway.

PDB

2RF0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14604	SH3_9	23 → 77	Variant SH3 domain	Domain
PF07714	PK_Tyr_Ser-Thr	98 → 357	Protein tyrosine and serine/threonine kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain and skeletal muscle.

Sequence

MEEEEGAVAKEWGTTPAGPVWTAVFDYEAAGDEELTLRRGDRVQVLSQDCAVSGDEGWWT
GQLPSGRVGVFPSNYVAPGAPAAPAGLQLPQEIPFHELQLEEIIGVGGFGKVYRALWRGE
EVAVKAARLDPEKDPAVTAEQVCQEARLFGALQHPNIIALRGACLNPPHLCLVMEYARGG
ALSRVLAGRRVPPHVLVNWAVQVARGMNYLHNDAPVPIIHRDLKSINILILEAIENHNLA
DTVLKITDFGLAREWHKTTKMSAAGTYAWMAPEVIRLSLFSKSSDVWSFGVLLWELLTGE
VPYREIDALAVAYGVAMNKLTLPIPSTCPEPFARLLEECWDPDPHGRPDFGSILKRLEVI
EQSALFQMPLESFHSLQEDWKLEIQHMFDDLRTKEKELRSREEELLRAAQEQRFQEEQLR
RREQELAEREMDIVERELHLLMCQLSQEKPRVRKRKGNFKRSRLLKLREGGSHISLPSGF
EHKITVQASPTLDKRKGSDGASPPASPSIIPRLRAIRLTPVDCGGSSSGSSSGGSGTWSR
GGPPKKEELVGGKKKGRTWGPSSTLQKERVGGEERLKGLGEGSKQWSSSAPNLGKSPKHT
PIAPGFASLNEMEEFAEAEDGGSSVPPSPYSTPSYLSVPLPAEPSPGARAPWEPTPSAPP
ARWGHGARRRCDLALLGCATLLGAVGLGADVAEARAADGEEQRRWLDGLFFPRAGRFPRG
LSPPARPHGRREDVGPGLGLAPSATLVSLSSVSDCNSTRSLLRSDSDEAAPAAPSPPPSP
PAPTPTPSPSTNPLVDLELESFKKDPRQSLTPTHVTAACAVSRGHRRTPSDGALGQRGPP
EPAGHGPGPRDLLDFPRLPDPQALFPARRRPPEFPGRPTTLTFAPRPRPAASRPRLDPWK
LVSFGRTLTISPPSRPDTPESPGPPSVQPTLLDMDMEGQNQDSTVPLCGAHGSH

Sequence length

954

Interactions

View interactions

	KEGG
	MAPK signaling pathway Huntington disease Pathways of neurodegeneration - multiple diseases

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Familial cancer of breast	Uncertain significance	rs376246139	RCV005937558

Show/Hide Text Mining Associations (8)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Cardiomyopathy infantile histiocytoid	Associate	25275525
Colorectal Neoplasms	Associate	23027623, 25541970
Down Syndrome	Associate	25476127
Fibrosis	Associate	35253468
Infections	Associate	23797008
Leukemia Megakaryoblastic Acute	Associate	25476127
Multiple Myeloma	Associate	37137439
Neoplasms	Inhibit	21944251, 23594797

MAP3K10 (mitogen-activated protein kinase kinase kinase 10)