Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4291
Gene name Gene Name - the full gene name approved by the HGNC.	Myeloid leukemia factor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MLF1
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3q25.32
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes an oncoprotein which is thought to play a role in the phenotypic determination of hemopoetic cells. Translocations between this gene and nucleophosmin have been associated with myelodysplastic syndrome and acute myeloid leukemia. Multipl

Show/Hide all(17)

miRTarBase ID	miRNA	Experiments	Reference
MIRT043951	hsa-miR-378a-3p	CLASH	23622248
MIRT042653	hsa-miR-422a	CLASH	23622248
MIRT1150959	hsa-miR-4698	CLIP-seq
MIRT1150960	hsa-miR-802	CLIP-seq
MIRT1150961	hsa-miR-105	CLIP-seq
MIRT1150962	hsa-miR-1323	CLIP-seq
MIRT1150963	hsa-miR-548o	CLIP-seq
MIRT2043054	hsa-miR-23a	CLIP-seq
MIRT2043055	hsa-miR-23b	CLIP-seq
MIRT2043056	hsa-miR-23c	CLIP-seq
MIRT2043057	hsa-miR-3647-3p	CLIP-seq
MIRT2043058	hsa-miR-3680	CLIP-seq
MIRT2043059	hsa-miR-4282	CLIP-seq
MIRT1150959	hsa-miR-4698	CLIP-seq
MIRT2043060	hsa-miR-4798-3p	CLIP-seq
MIRT2043061	hsa-miR-653	CLIP-seq
MIRT2272538	hsa-miR-543	CLIP-seq

Show/Hide all(23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002318	Process	Myeloid progenitor cell differentiation	ISS
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	ISS
GO:0005515	Function	Protein binding	IPI	12176995, 15861129, 16189514, 20374249, 22151054, 23414517, 25036637, 26871637, 28514442, 31515488, 33961781
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005929	Component	Cilium	IEA
GO:0005929	Component	Cilium	ISS
GO:0006351	Process	DNA-templated transcription	ISS
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0019904	Function	Protein domain specific binding	IDA	12176995
GO:0030154	Process	Cell differentiation	IEA
GO:0036064	Component	Ciliary basal body	ISS
GO:0042995	Component	Cell projection	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	15861129
GO:1901796	Process	Regulation of signal transduction by p53 class mediator	IPI	15861129
GO:1902806	Process	Regulation of cell cycle G1/S phase transition	IPI	15861129

MIM	HGNC	e!Ensembl
601402	7125	ENSG00000178053

Protein

UniProt ID

P58340

Protein name

Myeloid leukemia factor 1 (Myelodysplasia-myeloid leukemia factor 1)

Protein function

Involved in lineage commitment of primary hemopoietic progenitors by restricting erythroid formation and enhancing myeloid formation. Interferes with erythropoietin-induced erythroid terminal differentiation by preventing cells from exiting the

PDB

3UAL , 3UBW , 6Y8E

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10248	Mlf1IP	26 → 202	Myelodysplasia-myeloid leukemia factor 1-interacting protein	Family

Tissue specificity

TISSUE SPECIFICITY: Most abundant in testis, ovary, skeletal muscle, heart, kidney and colon. Low expression in spleen, thymus and peripheral blood leukocytes.

Sequence

MFRMLNSSFEDDPFFSESILAHRENMRQMIRSFSEPFGRDLLSISDGRGRAHNRRGHNDG
EDSLTHTDVSSFQTMDQMVSNMRNYMQKLERNFGQLSVDPNGHSFCSSSVMTYSKIGDEP
PKVFQASTQTRRAPGGIKETRKAMRDSDSGLEKMAIGHHIHDRAHVIKKSKNKKTGDEEV
NQEFINMNESDAHAFDEEWQSEVLKYKPGRHNLGNTRMRSVGHENPGSRELKRREKPQQS
PAIEHGRRSNVLGDKLHIKGSSVKSNKK

Sequence length

268

Interactions

View interactions

	KEGG
	Transcriptional misregulation in cancer

Show/Hide Unknown Diseases (5)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Heart Failure	Heart failure	N/A	N/A	GWAS
Insomnia	Insomnia	N/A	N/A	GWAS
Mental Depression	Major depressive disorder	N/A	N/A	GWAS
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS
Neuroticism	Neuroticism	N/A	N/A	GWAS

Show/Hide Text Mining Associations (10)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Autism Spectrum Disorder	Associate	28358038
Cholangiocarcinoma	Associate	37486965
Genetic Diseases Inborn	Associate	39711284
Leukemia	Associate	31675375
Leukemia Myeloid Acute	Associate	25027285, 31648321, 31675375
Myelodysplastic Syndromes	Associate	39711284
Neoplasms	Associate	23676460, 37486965
Neuroblastoma	Associate	28545128
Neuroendocrine Tumors	Associate	23676460
Stomach Neoplasms	Associate	16367923, 19375421

MLF1 (myeloid leukemia factor 1)