Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
429
Gene name Gene Name - the full gene name approved by the HGNC.
Achaete-scute family bHLH transcription factor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ASCL1
Synonyms (NCBI Gene) Gene synonyms aliases
ASH1, HASH1, MASH1, bHLHa46
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q23.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the basic helix-loop-helix (BHLH) family of transcription factors. The protein activates transcription by binding to the E box (5`-CANNTG-3`). Dimerization with other BHLH proteins is required for efficient DNA binding. This
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT438551 hsa-let-7i-5p ChIP-seq, GFP reporter assay, Immunocytochemistry, Immunohistochemistry, Luciferase reporter assay, qRT-PCR 23884650
MIRT438551 hsa-let-7i-5p ChIP-seq, GFP reporter assay, Immunocytochemistry, Immunohistochemistry, Luciferase reporter assay, qRT-PCR 23884650
MIRT438551 hsa-let-7i-5p ChIP-seq, GFP reporter assay, Immunocytochemistry, Immunohistochemistry, Luciferase reporter assay, qRT-PCR 23884650
MIRT438551 hsa-let-7i-5p ChIP-seq, GFP reporter assay, Immunocytochemistry, Immunohistochemistry, Luciferase reporter assay, qRT-PCR 23884650
MIRT438551 hsa-let-7i-5p ChIP-seq, GFP reporter assay, Immunocytochemistry, Immunohistochemistry, Luciferase reporter assay, qRT-PCR 23884650
Transcription factors
Transcription factor Regulation Reference
HES1 Repression 11054669;21573214;9144241
HES6 Repression 16103883
HNRNPR Unknown 25124043
LMO3 Activation 21573214
LMO3 Repression 21573214
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 11736660
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA 21873635
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 11736660
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
100790 738 ENSG00000139352
Protein
UniProt ID P50553
Protein name Achaete-scute homolog 1 (ASH-1) (hASH1) (Class A basic helix-loop-helix protein 46) (bHLHa46)
Protein function Transcription factor that plays a key role in neuronal differentiation: acts as a pioneer transcription factor, accessing closed chromatin to allow other factors to bind and activate neural pathways. Directly binds the E box motif (5'-CANNTG-3')
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00010 HLH 119 171 Helix-loop-helix DNA-binding domain Domain
Sequence
MESSAKMESGGAGQQPQPQPQQPFLPPAACFFATAAAAAAAAAAAAAQSAQQQQQQQQQQ
QQAPQLRPAADGQPSGGGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQQQPAAV
ARRNERERNRVKLVNLGFATLREHVPNGAANKKMSKVETLRSAVEYIRALQ
QLLDEHDAV
SAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNWF
Sequence length 236
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    NGF-stimulated transcription
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Congenital central hypoventilation Congenital central hypoventilation rs587776626, rs1733878065, rs761018157, rs779557320, rs772448418, rs775006915, rs1733941453, rs73810366
Dysautonomia Dysautonomia rs111033171, rs137853022, rs28939712, rs754348901, rs749052963, rs1057517169, rs1057516865, rs763445509, rs767527819, rs781333644, rs1239081703, rs1554696574, rs539544212, rs1201626345, rs774890086
View all (27 more)
Haddad syndrome CCHS WITH HIRSCHSPRUNG DISEASE, Haddad syndrome rs1297909281, rs587776626, rs1733941453, rs73810366
Hearing loss Sensorineural Hearing Loss (disorder) rs267607135, rs267606855, rs779841884, rs267606854, rs28942097, rs121908073, rs121908076, rs74315289, rs121908144, rs111033313, rs74315437, rs121908348, rs121908349, rs121908350, rs397515359
View all (184 more)
Unknown
Disease term Disease name Evidence References Source
Haddad Syndrome Haddad syndrome GenCC
Neurodevelopmental Disorders neurodevelopmental disorder GenCC
Schizophrenia Schizophrenia GWAS
Neuroticism Neuroticism GWAS
Associations from Text Mining
Disease Name Relationship Type References
Acute cholinergic dysautonomia Associate 29453933
Adenocarcinoma Associate 14657947, 24037524, 24078426, 28460442
Adenocarcinoma of Lung Associate 22696682, 24037524, 28460442, 30121393, 31292388, 35367201, 37801008
Anus Neoplasms Associate 30060049, 38160718
Bipolar Disorder Associate 37958729
Breast Neoplasms Associate 35690220
Carcinogenesis Associate 22696682, 23114535, 33191657
Carcinoid Tumor Associate 19765735, 22696682, 26403073, 39581377
Carcinoid Tumor Inhibit 26008974
Carcinoma Hepatocellular Inhibit 36755802