Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4285
Gene name Gene Name - the full gene name approved by the HGNC.	Mitochondrial intermediate peptidase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MIPEP
Synonyms (NCBI Gene) Gene synonyms aliases	COXPD31, HMIP, MIP
Disease Acronyms (UniProt) Disease acronyms from UniProt database	COXPD31
Chromosome Chromosome number	13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	13q12.12
Summary Summary of gene provided in NCBI Entrez Gene.	The product of this gene performs the final step in processing a specific class of nuclear-encoded proteins targeted to the mitochondrial matrix or inner membrane. This protein is primarily involved in the maturation of oxidative phosphorylation (OXPHOS)-

Show/Hide all(7)

SNP ID	Visualize variation	Clinical significance	Consequence
rs114638163	C>A,T	Benign, pathogenic	Stop gained, missense variant, coding sequence variant
rs143912947	G>A	Uncertain-significance, pathogenic	Missense variant, coding sequence variant
rs779598020	G>C	Pathogenic, uncertain-significance	Coding sequence variant, missense variant
rs780533096	C>G,T	Likely-pathogenic	Coding sequence variant, missense variant
rs1057518739	A>C	Uncertain-significance, pathogenic	Coding sequence variant, missense variant
rs1057518740	A>T	Uncertain-significance, pathogenic	Coding sequence variant, missense variant
rs1057518741	T>C	Uncertain-significance, pathogenic	Coding sequence variant, missense variant

Show/Hide all(14)

miRTarBase ID	miRNA	Experiments	Reference
MIRT032395	hsa-let-7b-5p	Proteomics	18668040
MIRT2042497	hsa-miR-1179	CLIP-seq
MIRT2042498	hsa-miR-3137	CLIP-seq
MIRT2042499	hsa-miR-4528	CLIP-seq
MIRT2042500	hsa-miR-4729	CLIP-seq
MIRT2042501	hsa-miR-495	CLIP-seq
MIRT2042497	hsa-miR-1179	CLIP-seq
MIRT2042498	hsa-miR-3137	CLIP-seq
MIRT2272126	hsa-miR-3168	CLIP-seq
MIRT2272127	hsa-miR-342-3p	CLIP-seq
MIRT2042499	hsa-miR-4528	CLIP-seq
MIRT2042500	hsa-miR-4729	CLIP-seq
MIRT2042501	hsa-miR-495	CLIP-seq
MIRT2272128	hsa-miR-561	CLIP-seq

Show/Hide all(8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004222	Function	Metalloendopeptidase activity	IBA	21873635
GO:0005739	Component	Mitochondrion	IBA	21873635
GO:0005739	Component	Mitochondrion	IDA
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0006508	Process	Proteolysis	IBA	21873635
GO:0006518	Process	Peptide metabolic process	IBA	21873635
GO:0006627	Process	Protein processing involved in protein targeting to mitochondrion	IBA	21873635
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
602241	7104	ENSG00000027001

Protein

UniProt ID

Q99797

Protein name

Mitochondrial intermediate peptidase (MIP) (EC 3.4.24.59)

Protein function

Cleaves proteins, imported into the mitochondrion, to their mature size.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01432	Peptidase_M3	254 → 699	Peptidase family M3	Family

Sequence

MLCVGRLGGLGARAAALPPRRAGRGSLEAGIRARRVSTSWSPVGAAFNVKPQGSRLDLFG
ERRGLFGVPELSAPEGFHIAQEKALRKTELLVDRACSTPPGPQTVLIFDELSDSLCRVAD
LADFVKIAHPEPAFREAAEEACRSIGTMVEKLNTNVDLYQSLQKLLADKKLVDSLDPETR
RVAELFMFDFEISGIHLDKEKRKRAVDLNVKILDLSSTFLMGTNFPNKIEKHLLPEHIRR
NFTSAGDHIIIDGLHAESPDDLVREAAYKIFLYPNAGQLKCLEELLSSRDLLAKLVGYST
FSHRALQGTIAKNPETVMQFLEKLSDKLSERTLKDFEMIRGMKMKLNPQNSEVMPWDPPY
YSGVIRAERYNIEPSLYCPFFSLGACMEGLNILLNRLLGISLYAEQPAKGEVWSEDVRKL
AVVHESEGLLGYIYCDFFQRADKPHQDCHFTIRGGRLKEDGDYQLPVVVLMLNLPRSSRS
SPTLLTPSMMENLFHEMGHAMHSMLGRTRYQHVTGTRCPTDFAEVPSILMEYFANDYRVV
NQFARHYQTGQPLPKNMVSRLCESKKVCAAADMQLQVFYATLDQIYHGKHPLRNSTTDIL
KETQEKFYGLPYVPNTAWQLRFSHLVGYGARYYSYLMSRAVASMVWKECFLQDPFNRAAG
ERYRREMLAHGGGREPMLMVEGMLQKCPSVDDFVSALVSDLDLDFETFLMDSE

Sequence length

713

Interactions

View interactions

Show/Hide Causal Diseases (8)

Disease term	Disease name	dbSNP ID	References
Causal
Cardiomyopathy	Cardiomyopathy, Dilated, Cardiomyopathies, Left ventricular noncompaction cardiomyopathy	rs267607003, rs267607002, rs267607004, rs63750743, rs121908333, rs121908334, rs104894655, rs121434420, rs121434421, rs193922674, rs111517471, rs121908987, rs193922384, rs121909374, rs121909377 View all (900 more)	27799064
Cerebral palsy	Cerebral Palsy	rs121918149, rs75184679, rs730880264, rs587777428, rs797045067, rs767399782, rs564185858, rs886039513
Combined oxidative phosphorylation deficiency	COMBINED OXIDATIVE PHOSPHORYLATION DEFICIENCY 31, Lethal left ventricular non-compaction-seizures-hypotonia-cataract-developmental delay syndrome	rs587776508, rs576462794, rs118203917, rs387906327, rs139430866, rs387906962, rs138119149, rs387907061, rs1562800908, rs397515421, rs397514598, rs397514610, rs397514611, rs397514612, rs201431517 View all (155 more)	25778941, 27799064
Developmental delay	Global developmental delay	rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291 View all (32 more)	27799064
Hypertrophic cardiomyopathy	Hypertrophic Cardiomyopathy	rs63750743, rs104894655, rs121908987, rs587776643, rs28938173, rs121908989, rs121908991, rs267606977, rs267606978, rs193922384, rs121909374, rs886041030, rs886041031, rs121909375, rs121909377 View all (752 more)
Left ventricular noncompaction	Left ventricular noncompaction	rs121913654, rs730880850, rs386134243, rs397515482, rs138110910, rs730880336, rs730880856, rs794729390, rs886037900, rs1114167338, rs1555338658	27799064
Myopia	Myopia, Degenerative	rs387907109, rs146936371, rs587776903, rs786205127, rs398122836, rs199624584, rs587777625, rs786205216, rs758872875, rs764211125, rs1135402746, rs765658563, rs1555941129, rs1555941116, rs199923805 View all (6 more)	21640322
Optic atrophy	Optic Atrophy	rs121434508, rs267607017, rs80356524, rs80356525, rs879255560, rs104893753, rs80356529, rs397515360, rs104893620, rs199476104, rs199476112, rs199476118, rs398124298, rs770066665, rs398124299 View all (37 more)

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Mitochondrial Diseases	mitochondrial disease			GenCC

Show/Hide Text Mining Associations (12)

Disease Name	Relationship Type	References
Associations from Text Mining
Anemia Sickle Cell	Associate	34706496
beta Thalassemia	Associate	25842369
Death	Associate	27799064
Developmental Disabilities	Associate	27799064
Hemolysis	Associate	32563256
Isolated Noncompaction of the Ventricular Myocardium	Associate	27799064
Lung Neoplasms	Associate	31126313
Metabolic Syndrome	Associate	31739726
Muscle Hypotonia	Associate	27799064
Myopia	Associate	21640322
Polypoidal Choroidal Vasculopathy	Associate	27799064
Vasculopathy Retinal With Cerebral Leukodystrophy	Associate	32563256

MIPEP (mitochondrial intermediate peptidase)