Gene Gene information from NCBI Gene database.
Entrez ID 4283
Gene name C-X-C motif chemokine ligand 9
Gene symbol CXCL9
Synonyms (NCBI Gene)
CMKHumigMIGSCYB9crg-10
Chromosome 4
Chromosome location 4q21.1
Summary This antimicrobial gene is part of a chemokine superfamily that encodes secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded is thought to be involved in T cell trafficking. The encoded protein binds to C-X-C moti
miRNA miRNA information provided by mirtarbase database.
46
miRTarBase ID miRNA Experiments Reference
MIRT016944 hsa-miR-335-5p Microarray 18185580
MIRT025283 hsa-miR-34a-5p Proteomics 21566225
MIRT028888 hsa-miR-26b-5p Microarray 19088304
MIRT736789 hsa-miR-588 Western blottingImmunohistochemistry (IHC)qRT-PCR 33323542
MIRT918121 hsa-miR-1251 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
40
GO ID Ontology Definition Evidence Reference
GO:0005125 Function Cytokine activity IEA
GO:0005125 Function Cytokine activity TAS 2115167
GO:0005515 Function Protein binding IPI 18275857, 21314817, 25416956, 28381538, 31515488, 32296183
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601704 7098 ENSG00000138755
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q07325
Protein name C-X-C motif chemokine 9 (Gamma-interferon-induced monokine) (Monokine induced by interferon-gamma) (HuMIG) (MIG) (Small-inducible cytokine B9)
Protein function Cytokine that affects the growth, movement, or activation state of cells that participate in immune and inflammatory response. Chemotactic for activated T-cells. Binds to CXCR3.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00048 IL8 29 89 Small cytokines (intecrine/chemokine), interleukin-8 like Domain
Sequence
MKKSGVLFLLGIILLVLIGVQGTPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEK
IEIIATLKNGVQTCLNPDSADVKELIKKW
EKQVSQKKKQKNGKKHQKKKVLKVRKSQRSR
QKKTT
Sequence length 125
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
Toll-like receptor signaling pathway
  Chemokine receptors bind chemokines
G alpha (i) signalling events