Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4283
Gene name Gene Name - the full gene name approved by the HGNC.	C-X-C motif chemokine ligand 9
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CXCL9
Synonyms (NCBI Gene) Gene synonyms aliases	CMK, Humig, MIG, SCYB9, crg-10
Chromosome Chromosome number	4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	4q21.1
Summary Summary of gene provided in NCBI Entrez Gene.	This antimicrobial gene is part of a chemokine superfamily that encodes secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded is thought to be involved in T cell trafficking. The encoded protein binds to C-X-C moti

Show/Hide all(46)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016944	hsa-miR-335-5p	Microarray	18185580
MIRT025283	hsa-miR-34a-5p	Proteomics	21566225
MIRT028888	hsa-miR-26b-5p	Microarray	19088304
MIRT736789	hsa-miR-588	Western blotting, Immunohistochemistry (IHC), qRT-PCR	33323542
MIRT918121	hsa-miR-1251	CLIP-seq
MIRT918122	hsa-miR-1252	CLIP-seq
MIRT918123	hsa-miR-1270	CLIP-seq
MIRT918124	hsa-miR-1278	CLIP-seq
MIRT918125	hsa-miR-1293	CLIP-seq
MIRT918126	hsa-miR-1321	CLIP-seq
MIRT918127	hsa-miR-185	CLIP-seq
MIRT918128	hsa-miR-3162-5p	CLIP-seq
MIRT918129	hsa-miR-3529	CLIP-seq
MIRT918130	hsa-miR-379	CLIP-seq
MIRT918131	hsa-miR-412	CLIP-seq
MIRT918132	hsa-miR-4272	CLIP-seq
MIRT918133	hsa-miR-4306	CLIP-seq
MIRT918134	hsa-miR-4451	CLIP-seq
MIRT918135	hsa-miR-4456	CLIP-seq
MIRT918136	hsa-miR-4483	CLIP-seq
MIRT918137	hsa-miR-4531	CLIP-seq
MIRT918138	hsa-miR-4536	CLIP-seq
MIRT918139	hsa-miR-4644	CLIP-seq
MIRT918140	hsa-miR-4650-3p	CLIP-seq
MIRT918141	hsa-miR-4666-5p	CLIP-seq
MIRT918142	hsa-miR-4670-3p	CLIP-seq
MIRT918143	hsa-miR-4739	CLIP-seq
MIRT918144	hsa-miR-4756-5p	CLIP-seq
MIRT918145	hsa-miR-541	CLIP-seq
MIRT918146	hsa-miR-582-3p	CLIP-seq
MIRT918147	hsa-miR-620	CLIP-seq
MIRT918148	hsa-miR-654-5p	CLIP-seq
MIRT1972134	hsa-miR-4434	CLIP-seq
MIRT1972135	hsa-miR-4516	CLIP-seq
MIRT918137	hsa-miR-4531	CLIP-seq
MIRT2207943	hsa-miR-135a	CLIP-seq
MIRT2207944	hsa-miR-135b	CLIP-seq
MIRT2207945	hsa-miR-4433	CLIP-seq
MIRT2207946	hsa-miR-4481	CLIP-seq
MIRT2207947	hsa-miR-4701-5p	CLIP-seq
MIRT2207948	hsa-miR-4717-3p	CLIP-seq
MIRT2207949	hsa-miR-4724-5p	CLIP-seq
MIRT2207950	hsa-miR-4745-5p	CLIP-seq
MIRT2207951	hsa-miR-4758-5p	CLIP-seq
MIRT2207952	hsa-miR-494	CLIP-seq
MIRT2386611	hsa-miR-4793-5p	CLIP-seq

Show/Hide all(40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005125	Function	Cytokine activity	IEA
GO:0005125	Function	Cytokine activity	TAS	2115167
GO:0005515	Function	Protein binding	IPI	18275857, 21314817, 25416956, 28381538, 31515488, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	8476424
GO:0006935	Process	Chemotaxis	IDA	12782716
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	TAS	10903763
GO:0006952	Process	Defense response	IEA
GO:0006952	Process	Defense response	TAS	2115167
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	TAS	10903763
GO:0006955	Process	Immune response	IEA
GO:0006968	Process	Cellular defense response	TAS	10570316
GO:0007165	Process	Signal transduction	TAS	10201891, 10201901
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	10903763
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	12782716
GO:0007267	Process	Cell-cell signaling	TAS	8476424
GO:0008009	Function	Chemokine activity	IBA
GO:0008009	Function	Chemokine activity	IDA	12782716
GO:0008009	Function	Chemokine activity	IEA
GO:0008009	Function	Chemokine activity	TAS	10903763
GO:0009617	Process	Response to bacterium	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0030593	Process	Neutrophil chemotaxis	IBA
GO:0031640	Process	Killing of cells of another organism	IDA	12949249
GO:0042127	Process	Regulation of cell population proliferation	IDA	12782716
GO:0045236	Function	CXCR chemokine receptor binding	IBA
GO:0045663	Process	Positive regulation of myoblast differentiation	IEA
GO:0048248	Function	CXCR3 chemokine receptor binding	IDA	12782716
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	IDA	12782716
GO:0051607	Process	Defense response to virus	IEA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	12949249
GO:0070098	Process	Chemokine-mediated signaling pathway	IBA
GO:0071222	Process	Cellular response to lipopolysaccharide	IBA
GO:1901741	Process	Positive regulation of myoblast fusion	IEA

MIM	HGNC	e!Ensembl
601704	7098	ENSG00000138755

Protein

UniProt ID

Q07325

Protein name

C-X-C motif chemokine 9 (Gamma-interferon-induced monokine) (Monokine induced by interferon-gamma) (HuMIG) (MIG) (Small-inducible cytokine B9)

Protein function

Cytokine that affects the growth, movement, or activation state of cells that participate in immune and inflammatory response. Chemotactic for activated T-cells. Binds to CXCR3.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00048	IL8	29 → 89	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

Sequence

MKKSGVLFLLGIILLVLIGVQGTPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEK
IEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSR
QKKTT

Sequence length

125

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor Chemokine signaling pathway Toll-like receptor signaling pathway		Chemokine receptors bind chemokines G alpha (i) signalling events

CXCL9 (C-X-C motif chemokine ligand 9)