MIF (macrophage migration inhibitory factor)

Gene

• Entrez ID: 4282
• Gene name: Macrophage migration inhibitory factor
• Gene symbol: MIF
• Synonyms (NCBI Gene): GIF, GLIF, MMIF
• Chromosome: 22
• Chromosome location: 22q11.23
• Summary: This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This l

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000664	hsa-miR-338-3p	Review	19935707
MIRT000046	hsa-miR-451a	Review	20026422
MIRT000046	hsa-miR-451a	ELISA, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	19318487
MIRT000046	hsa-miR-451a	ELISA, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	19318487
MIRT044670	hsa-miR-320a	CLASH	23622248
MIRT039145	hsa-miR-769-5p	CLASH	23622248
MIRT037678	hsa-miR-744-5p	CLASH	23622248
MIRT000046	hsa-miR-451a	Luciferase reporter assay, Western blot	24138931
MIRT000046	hsa-miR-451a	Luciferase reporter assay	26884830
MIRT000046	hsa-miR-451a	Luciferase reporter assay	28086136
MIRT000046	hsa-miR-451a	Luciferase reporter assay	28086136
MIRT000046	hsa-miR-451a	RNA-seq	33804111
MIRT733489	hsa-miR-1246	qRT-PCR, Western blotting	34112884
MIRT000046	hsa-miR-451a	qRT-PCR, Western blotting	34112884
MIRT734259	hsa-miR-654-5p	Luciferase reporter assay, Western blotting, qRT-PCR, ELISA	31608058
MIRT000046	hsa-miR-451a	Luciferase reporter assay	38379319
MIRT1149085	hsa-miR-1324	CLIP-seq
MIRT1149086	hsa-miR-1537	CLIP-seq
MIRT1149087	hsa-miR-2277-3p	CLIP-seq
MIRT1149088	hsa-miR-3166	CLIP-seq
MIRT1149089	hsa-miR-3170	CLIP-seq
MIRT1149090	hsa-miR-342-5p	CLIP-seq
MIRT1149091	hsa-miR-3960	CLIP-seq
MIRT1149092	hsa-miR-451	CLIP-seq
MIRT1149093	hsa-miR-4532	CLIP-seq
MIRT1149094	hsa-miR-4651	CLIP-seq
MIRT1149095	hsa-miR-4664-5p	CLIP-seq
MIRT1149096	hsa-miR-4713-5p	CLIP-seq
MIRT1149097	hsa-miR-4738-5p	CLIP-seq
MIRT1149098	hsa-miR-4773	CLIP-seq
MIRT1149099	hsa-miR-541	CLIP-seq
MIRT1149100	hsa-miR-608	CLIP-seq
MIRT1149085	hsa-miR-1324	CLIP-seq
MIRT1149086	hsa-miR-1537	CLIP-seq
MIRT1149087	hsa-miR-2277-3p	CLIP-seq
MIRT1149088	hsa-miR-3166	CLIP-seq
MIRT1149089	hsa-miR-3170	CLIP-seq
MIRT1149090	hsa-miR-342-5p	CLIP-seq
MIRT1149091	hsa-miR-3960	CLIP-seq
MIRT2042438	hsa-miR-4286	CLIP-seq
MIRT1149092	hsa-miR-451	CLIP-seq
MIRT1149093	hsa-miR-4532	CLIP-seq
MIRT1149094	hsa-miR-4651	CLIP-seq
MIRT1149095	hsa-miR-4664-5p	CLIP-seq
MIRT1149096	hsa-miR-4713-5p	CLIP-seq
MIRT1149097	hsa-miR-4738-5p	CLIP-seq
MIRT1149098	hsa-miR-4773	CLIP-seq
MIRT1149099	hsa-miR-541	CLIP-seq
MIRT1149100	hsa-miR-608	CLIP-seq
MIRT1149085	hsa-miR-1324	CLIP-seq
MIRT1149087	hsa-miR-2277-3p	CLIP-seq
MIRT1149088	hsa-miR-3166	CLIP-seq
MIRT1149091	hsa-miR-3960	CLIP-seq
MIRT1149093	hsa-miR-4532	CLIP-seq
MIRT1149097	hsa-miR-4738-5p	CLIP-seq
MIRT1149098	hsa-miR-4773	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
HBP1	Repression	20383199
HIF1A	Activation	20727156
NFKB1	Unknown	18710704
RELA	Unknown	18710704
SP1	Activation	18034423

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001516	Process	Prostaglandin biosynthetic process	IDA	12782713
GO:0001819	Process	Positive regulation of cytokine production	IDA	19602265
GO:0004167	Function	Dopachrome isomerase activity	IDA	17526494
GO:0005125	Function	Cytokine activity	IDA	12782713
GO:0005126	Function	Cytokine receptor binding	IDA	21817065
GO:0005126	Function	Cytokine receptor binding	IPI	17045821
GO:0005515	Function	Protein binding	IPI	12681488, 17526494, 18677096, 25416956, 26280537, 28726057, 31515488
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	IDA	12782713
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	21817065
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	24569872
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA	24569872
GO:0006954	Process	Inflammatory response	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IDA	12782713
GO:0009986	Component	Cell surface	IDA	12782713
GO:0010629	Process	Negative regulation of gene expression	IDA	10562313
GO:0010739	Process	Positive regulation of protein kinase A signaling	IDA	17045821
GO:0010760	Process	Negative regulation of macrophage chemotaxis	IDA	21817065
GO:0019752	Process	Carboxylic acid metabolic process	IDA	12782713
GO:0030336	Process	Negative regulation of cell migration	IMP	22952837
GO:0030890	Process	Positive regulation of B cell proliferation	IDA	12782713
GO:0031982	Component	Vesicle	HDA	19190083
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IDA	21817065
GO:0033138	Process	Positive regulation of peptidyl-serine phosphorylation	IDA	17045821
GO:0034774	Component	Secretory granule lumen	TAS
GO:0035722	Process	Interleukin-12-mediated signaling pathway	TAS
GO:0042056	Function	Chemoattractant activity	IDA	19602265
GO:0042327	Process	Positive regulation of phosphorylation	IDA	12782713
GO:0042802	Function	Identical protein binding	IPI	20534506, 25416956, 31515488, 32296183
GO:0043030	Process	Regulation of macrophage activation	NAS	12782713
GO:0043066	Process	Negative regulation of apoptotic process	IDA	12782713
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0043518	Process	Negative regulation of DNA damage response, signal transduction by p53 class mediator	IDA	17045821
GO:0045087	Process	Innate immune response	IEA
GO:0048146	Process	Positive regulation of fibroblast proliferation	IDA	12782713
GO:0050178	Function	Phenylpyruvate tautomerase activity	IDA	16285950, 21817065
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IDA	17045821
GO:0050900	Process	Leukocyte migration	TAS
GO:0050918	Process	Positive chemotaxis	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145
GO:0070207	Process	Protein homotrimerization	IPI	17526494
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	12782713, 17045821
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IGI	21817065
GO:0071157	Process	Negative regulation of cell cycle arrest	IDA	10562313
GO:0090344	Process	Negative regulation of cell aging	IDA	10562313
GO:1902166	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IDA	17045821
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

Other IDs

• MIM: 153620
• HGNC: 7097
• e!Ensembl: ENSG00000240972

Protein

• UniProt ID: P14174
• Protein name: Macrophage migration inhibitory factor (MIF) (EC 5.3.2.1) (Glycosylation-inhibiting factor) (GIF) (L-dopachrome isomerase) (L-dopachrome tautomerase) (EC 5.3.3.12) (Phenylpyruvate tautomerase)
• Protein function: Pro-inflammatory cytokine involved in the innate immune response to bacterial pathogens (PubMed:15908412, PubMed:17443469, PubMed:23776208). The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of
• PDB: 1CA7, 1CGQ, 1GCZ, 1GD0, 1GIF, 1LJT, 1MIF, 1P1G, 2OOH, 2OOW, 2OOZ, 3B9S, 3CE4, 3DJH, 3DJI, 3HOF, 3IJG, 3IJJ, 3JSF, 3JSG, 3JTU, 3L5P, 3L5R, 3L5S, 3L5T, 3L5U, 3L5V, 3SMB, 3SMC, 3U18, 3WNR, 3WNS, 3WNT, 4ETG, 4EUI, 4EVG, 4F2K, 4GRN, 4GRO, 4GRP, 4GRQ, 4GRR, 4GRU, 4GUM, 4K9G, 4OSF, 4OYQ, 4P01, 4P0H, 4PKK, 4PKZ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01187	MIF	2 → 115	Macrophage migration inhibitory factor (MIF)	Domain

• Sequence:

  MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC
  SLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

• Sequence length: 115

Pathways

KEGG:

Tyrosine metabolism
Phenylalanine metabolism
Metabolic pathways

Reactome:

Cell surface interactions at the vascular wall
Neutrophil degranulation
Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Arthritis	Systemic onset juvenile chronic arthritis, Juvenile arthritis, Systemic-onset juvenile idiopathic arthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470
Autism	Autistic Disorder	rs121964908, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699, rs1553510219, rs1684182454, rs1559060428, rs1553510677, rs1576352885, rs1574152522, rs1574152672, rs1696658542	18676531
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158, rs80357524, rs80357115, rs80357945, rs80357729, rs80357609, rs80357259, rs80357981, rs80358063, rs80357389, rs80356862, rs80359876, rs80357580, rs80358053, rs80358089, rs80187739, rs397507241, rs80358069, rs80357590, rs80357284, rs80357941, rs80359261, rs80359272, rs80359276, rs276174813, rs80358474, rs80359316, rs1555282969, rs80359388, rs80359499, rs80359505, rs80359520, rs80359526, rs80359533, rs56253082, rs80358824, rs80359554, rs80359636, rs80359651, rs80359659, rs80359011, rs80359012, rs80359013, rs80359718, rs397507410, rs81002812, rs80359730, rs80359152, rs80359159, rs397507419, rs28897759, rs80359211, rs80359775, rs397514577, rs397507584, rs80358435, rs80358456, rs80359340, rs80359343, rs80359365, rs80358579, rs397507670, rs80358593, rs80359406, rs80359444, rs80359454, rs276174853, rs276174854, rs80359483, rs80359537, rs80358815, rs80358843, rs80359558, rs80359560, rs80359594, rs80358893, rs28897743, rs397507900, rs397507906, rs397507918, rs80358971, rs80358981, rs397507941, rs80359030, rs80359035, rs41293511, rs397507396, rs81002806, rs80359112, rs397508006, rs81002893, rs45580035, rs80359760, rs397508051, rs80359772, rs4987049, rs80359777, rs80357770, rs397508867, rs62625303, rs397508874, rs80357506, rs80357287, rs273898674, rs80358042, rs80358083, rs80357058, rs41286296, rs80357960, rs80356945, rs80357223, rs386134270, rs80358116, rs80357856, rs80357424, rs397509050, rs80357485, rs80357966, rs397509067, rs80357310, rs80356866, rs80357260, rs80357437, rs80358023, rs80358086, rs80357133, rs80356993, rs80357997, rs80357239, rs80357227, rs397509243, rs80356969, rs80356959, rs63750617, rs63751319, rs587779315, rs200640585, rs398122546, rs80357543, rs398122687, rs80359328, rs398122779, rs398122783, rs62517194, rs80358029, rs515726060, rs180177103, rs180177111, rs180177133, rs587776527, rs180177135, rs180177136, rs515726117, rs587779813, rs587779909, rs587780024, rs587780100, rs28909982, rs121908698, rs180177100, rs587780210, rs587780240, rs587780639, rs587781269, rs587781353, rs587781471, rs587781658, rs587781697, rs587781730, rs587781894, rs587781948, rs587782005, rs587782011, rs200928781, rs587781558, rs370228071, rs587782245, rs587782401, rs180177110, rs587782504, rs72552322, rs587782531, rs587782620, rs587782680, rs587782774, rs587782818, rs730881411, rs730881389, rs564652222, rs397507768, rs587776419, rs730881868, rs730881940, rs56383036, rs758972589, rs201089102, rs730881348, rs786202608, rs786201886, rs786203318, rs786203775, rs786203714, rs786202033, rs750621215, rs786203884, rs786203650, rs772821016, rs863224521, rs864622223, rs864622655, rs375699023, rs876659572, rs768362387, rs876659535, rs876658957, rs483353072, rs876659435, rs267608041, rs876661113, rs730881369, rs878853535, rs772228129, rs878855122, rs760551339, rs80359596, rs397509222, rs886039630, rs886039683, rs886040828, rs587781799, rs886040374, rs886040649, rs397507967, rs878854957, rs886040043, rs1057517589, rs1060502769, rs866380588, rs863224765, rs1064793243, rs747563556, rs1555074976, rs1064795885, rs753961188, rs1064794708, rs869312772, rs1064793887, rs1131690820, rs1135401928, rs1135401868, rs1135401859, rs1553370324, rs397507630, rs1555283160, rs1555283251, rs1555283262, rs1555283361, rs1555286298, rs1555288462, rs886040950, rs1555289566, rs776323117, rs80357123, rs1555579627, rs1555580697, rs80358054, rs1555593302, rs1328985852, rs763470424, rs1555139694, rs878854697, rs1555461217, rs1555461765, rs774684620, rs766416564, rs1554558613, rs1305740166, rs1555461460, rs1555461407, rs1555461586, rs1555567202, rs1555607022, rs1555069815, rs1442299125, rs1474786480, rs1555084947, rs1555457867, rs141087784, rs1482641121, rs1564830522, rs1565469955, rs1565503137, rs864622613, rs755263466, rs757679199, rs1593903166, rs1597801649, rs1603293306, rs879253880, rs80358754, rs1597062038, rs45494092, rs1603275367, rs887358871, rs1597091518, rs1966967065, rs1064793049, rs2082872908, rs2085078278, rs2072475243	19602265
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451, rs397507859, rs80359709, rs80359742, rs80359205, rs80357627, rs80357004, rs80357571, rs80357767, rs80357653, rs80358086, rs80357608, rs28897696, rs41293465, rs146650273, rs63751017, rs63750617, rs63750726, rs63750199, rs63749848, rs398122618, rs398122653, rs397509211, rs80357791, rs121912666, rs587778541, rs121908698, rs536907995, rs587781302, rs140342925, rs587781506, rs587782652, rs587782849, rs587783057, rs139770721, rs374950566, rs786202800, rs863224451, rs377153250, rs747727055, rs876658804, rs780001540, rs760815829, rs878854926, rs775248597, rs886040658, rs886040192, rs786203523, rs886040319, rs397508006, rs587782011, rs1060502772, rs1555461727, rs1553333072, rs1114167702, rs1257401983, rs886040950, rs1060502759, rs774684620, rs142947311, rs1555580883, rs748513310, rs376170600, rs863224499, rs1593909229, rs748453607, rs1294578913, rs1574737047, rs1593909960, rs2081922847, rs2082559544, rs2053694038	19602265
Carcinoma	Carcinoma, Carcinoma, Spindle-Cell, Undifferentiated carcinoma	rs121912654, rs555607708, rs786202962, rs1564055259	12376462
Marfan syndrome	Mammary Carcinoma, Human	rs137854456, rs137854457, rs267606796, rs137854458, rs137854459, rs137854460, rs137854470, rs137854471, rs267606797, rs137854461, rs137854462, rs137854463, rs869025419, rs137854464, rs137854465, rs137854466, rs137854467, rs387906547, rs387906548, rs137854469, rs137854473, rs1131692050, rs112989722, rs137854474, rs137854476, rs140593, rs1555395819, rs137854478, rs137854479, rs137854480, rs137854481, rs137854482, rs137854483, rs137854484, rs137854485, rs112289537, rs193922181, rs193922182, rs193922185, rs140603, rs193922187, rs193922188, rs193921256, rs112660651, rs193922193, rs193922194, rs193922197, rs193922198, rs193922199, rs193922203, rs193922204, rs193922205, rs193922206, rs111401431, rs193922207, rs113871094, rs111671429, rs193922216, rs193922219, rs193922220, rs193922223, rs193922224, rs193922225, rs193922226, rs193922227, rs193922228, rs193922230, rs193922235, rs147195031, rs193922236, rs193922239, rs193922240, rs193922241, rs193922246, rs397514558, rs398122934, rs397515753, rs397515754, rs397515755, rs397515756, rs397515757, rs113812345, rs397515758, rs397515759, rs397515762, rs25403, rs397515765, rs397515766, rs397515767, rs397515768, rs397515769, rs397515770, rs397515771, rs25404, rs397515773, rs397515774, rs397515775, rs397515776, rs397515778, rs397515779, rs397515781, rs112202622, rs397515782, rs397515784, rs397515785, rs397515786, rs397515788, rs397515789, rs397515790, rs397515791, rs397515792, rs397515793, rs397515794, rs397515797, rs397515798, rs397515799, rs397515801, rs397515802, rs397515803, rs397515804, rs397515805, rs397515808, rs397515810, rs397515811, rs397515812, rs111231312, rs267606798, rs397515814, rs113905529, rs397515816, rs397515817, rs397515818, rs397515819, rs397515820, rs363853, rs113249837, rs397515821, rs111929350, rs397515823, rs397515824, rs113086760, rs397515825, rs397515826, rs397515827, rs363807, rs397515828, rs397515829, rs397515830, rs397515831, rs397515833, rs111687884, rs113080385, rs397515834, rs397515836, rs113001196, rs397515840, rs397515845, rs397515846, rs397515847, rs397515848, rs397515851, rs397515852, rs397515853, rs397515854, rs111856492, rs397515859, rs397515861, rs397515863, rs397515864, rs397515865, rs397515866, rs397515867, rs137854855, rs199474693, rs587782944, rs587782947, rs587782948, rs672601352, rs876658120, rs727504651, rs727503054, rs727504315, rs727504411, rs727503057, rs727504454, rs200309328, rs363811, rs727504410, rs363821, rs727504347, rs727505006, rs727505110, rs730880356, rs727505269, rs727503058, rs727504421, rs730880107, rs730880104, rs730880103, rs730880102, rs730880101, rs730880106, rs730880100, rs730880105, rs730880099, rs112645512, rs730880108, rs730880098, rs730880097, rs794728321, rs794728283, rs794728280, rs794728336, rs794728272, rs794728160, rs794728271, rs794728270, rs794728319, rs794728262, rs794728251, rs76702162, rs794728335, rs794728334, rs794728246, rs763091520, rs794728333, rs794728237, rs761857514, rs794728234, rs140630, rs794728231, rs794728228, rs794728225, rs794728308, rs794728216, rs794728221, rs763449629, rs201058219, rs794728210, rs794728208, rs794728206, rs794728199, rs794728195, rs794728194, rs794728193, rs794728190, rs1555399381, rs794728176, rs1555399968, rs113422242, rs794728326, rs794728166, rs794728325, rs794728165, rs794728162, rs794728213, rs869025417, rs112642323, rs869025416, rs869025415, rs869025424, rs869025423, rs869025414, rs869025422, rs869025413, rs869025412, rs869025411, rs869025418, rs869025426, rs869025406, rs869025421, rs869025425, rs869025404, rs869025420, rs869025403, rs398122833, rs876657645, rs878853686, rs878853676, rs886038919, rs886038795, rs187553035, rs886038869, rs886038949, rs886038967, rs886038976, rs886038848, rs886038940, rs886038877, rs886039038, rs886038817, rs886038963, rs886039036, rs886038797, rs886039550, rs886041482, rs1057517855, rs1057518912, rs1057518973, rs1057519502, rs1057521100, rs1057521102, rs1057518881, rs1057520617, rs1057521101, rs1555394445, rs369058466, rs1060501069, rs1060501031, rs778966916, rs1060501043, rs1555397663, rs1060501017, rs1060501094, rs1060501065, rs1555393848, rs1555394151, rs1060501051, rs1060501013, rs1060501054, rs1060501048, rs1060501089, rs1060501039, rs1555398160, rs1060501022, rs1060501024, rs1060501086, rs1060501058, rs1060501036, rs1060501100, rs1060501042, rs1060501059, rs1555397743, rs1060501021, rs1060501027, rs1060501096, rs1060501038, rs1060501050, rs1064794130, rs112118237, rs1064793980, rs1064793118, rs1064793636, rs1064794282, rs1064793559, rs1085307921, rs1085308004, rs1085307468, rs112907302, rs1131691479, rs1131691373, rs1131691467, rs1131691938, rs1131691311, rs1131691806, rs1131691317, rs1555393827, rs363804, rs1555397738, rs1555399144, rs1555400274, rs1555394195, rs1555398836, rs113543334, rs1555399825, rs1555394626, rs1555395256, rs1555395257, rs1555396427, rs1555397548, rs1555398173, rs1555404803, rs1232880706, rs1555393825, rs1555394567, rs1555396998, rs1555394928, rs1555397203, rs112375043, rs1555397720, rs140599, rs1555399150, rs1555400373, rs1555405041, rs1555395229, rs1555397671, rs775417975, rs1555398774, rs1555399368, rs1555394904, rs1555395987, rs1555397424, rs1555398377, rs1555398835, rs1555401011, rs1555405043, rs1555394580, rs1555397404, rs1555398511, rs1555395826, rs1555399372, rs1555399821, rs1555399836, rs1555400063, rs363810, rs1555397655, rs1555395756, rs1555395742, rs1555393844, rs112550005, rs1555395002, rs1555395658, rs765387131, rs1555396429, rs1555396835, rs1555397014, rs1555397016, rs778710767, rs1555397557, rs1555397704, rs140648, rs1555398406, rs1555398681, rs1555399257, rs1555399361, rs1555399764, rs1555405056, rs1555393510, rs1555395980, rs1555396789, rs1555399094, rs1555399378, rs1555399816, rs1555395645, rs371097218, rs1555398278, rs1555394238, rs1555396418, rs1206813753, rs1555399271, rs1555405044, rs113544411, rs1555395663, rs1555397216, rs1555398989, rs1555399149, rs1555401670, rs1555395001, rs1445085747, rs1555393538, rs1555393565, rs1404133653, rs1555394450, rs1555394581, rs1555394633, rs1555394900, rs1555395189, rs1555395261, rs1052480459, rs1555395480, rs1555395670, rs363806, rs1555395820, rs1555396419, rs1555396765, rs1296209846, rs794728233, rs1555396853, rs1555396863, rs1555397197, rs1555397204, rs1555397212, rs1555397713, rs1555397736, rs1555398139, rs1555398144, rs1555398409, rs1555398510, rs1555398520, rs1555398524, rs1555398667, rs1555399089, rs1555399482, rs1555399763, rs1555401002, rs794728323, rs1555393508, rs1555393514, rs1555393525, rs1555393532, rs1555393653, rs1555393657, rs1555393824, rs1555393831, rs112196241, rs1555393847, rs1555393862, rs1555393863, rs1555393866, rs113935744, rs1555393882, rs1555393886, rs1555393889, rs1555394138, rs1555394144, rs1555394146, rs1555394148, rs1555394149, rs1555394152, rs1555394153, rs1555394189, rs1555394197, rs1555394206, rs1555394212, rs1555394218, rs1555394220, rs1555394235, rs1555394245, rs1555394246, rs1057520728, rs1555394390, rs1555394391, rs537570299, rs1555394397, rs1555394398, rs1555394399, rs1555394402, rs1555394407, rs1555394412, rs1555394435, rs1555394436, rs1555394441, rs1555394556, rs1555394557, rs1555394559, rs1555394561, rs1555394570, rs397515844, rs1555394571, rs1555394574, rs1555394579, rs1555394582, rs534811966, rs111588631, rs1555394628, rs1555394629, rs1555394630, rs1555394631, rs1555394641, rs1555394644, rs1555394647, rs1555394756, rs886051245, rs1555394775, rs1555394776, rs1555394777, rs1555394779, rs1555394780, rs1555394783, rs1555394901, rs1555394906, rs1555394925, rs794728253, rs886039158, rs1555395013, rs1555395187, rs1555395188, rs1555395203, rs1555395205, rs363815, rs1246984265, rs794728245, rs1555395263, rs1555395267, rs1555395456, rs1555395475, rs1555395482, rs1555395638, rs1555395641, rs1555395648, rs1555395653, rs1555395659, rs111239111, rs1555395745, rs1555395747, rs1555395753, rs1555395757, rs1555395766, rs1555395767, rs1555395843, rs1555395846, rs1555395849, rs1555395978, rs1555395981, rs1555395984, rs1555395989, rs1555395990, rs1260109901, rs1555396186, rs1555396188, rs1555396198, rs1555396199, rs1555396201, rs1555396202, rs1555396205, rs1555396213, rs1555396424, rs1555396426, rs1555396428, rs1555396435, rs1555396630, rs1555396635, rs1555396636, rs1555396639, rs1555396757, rs1555396769, rs1555396838, rs1555396844, rs140627, rs1555396858, rs1555396990, rs1555396991, rs1555396993, rs769588424, rs1555397022, rs1555397024, rs1555397160, rs1555397174, rs1555397176, rs1555397193, rs1555397209, rs1555397210, rs1555397214, rs1060501076, rs113082854, rs113693945, rs111978932, rs1555397403, rs1555397419, rs1555397420, rs1555397421, rs1555397536, rs1555397537, rs1555397540, rs1555397542, rs1555397543, rs1555397545, rs1555397546, rs1555397670, rs1555397692, rs1555397718, rs1555397723, rs1555397744, rs113393517, rs1555398148, rs1555398152, rs1555398174, rs1555398176, rs1555398179, rs1555398282, rs1555398287, rs1555398380, rs1555398394, rs1555398397, rs1555398401, rs1555398404, rs1555398407, rs1555398413, rs1555398501, rs1555398508, rs1555398512, rs1555398513, rs1555398515, rs1555398521, rs794728205, rs1555398527, rs1555398551, rs1060501075, rs1555398566, rs1555398572, rs1555398580, rs1555398582, rs140597, rs1555398622, rs1555398624, rs1555398625, rs112547596, rs1555398627, rs1555398633, rs1555398637, rs1555398642, rs778867355, rs1555398648, rs1555398659, rs1293095681, rs1060501040, rs987202268, rs1555398672, rs1555398673, rs1555398677, rs1555398793, rs1555398803, rs1555398811, rs1555398826, rs1555398833, rs1555398974, rs1555398981, rs778900586, rs1555398988, rs1555398994, rs1555398995, rs1555398996, rs1555399093, rs869025405, rs1555399101, rs1555399146, rs1555399160, rs1555399162, rs1555399164, rs1555399165, rs1555399193, rs1555399195, rs1555399202, rs1555399204, rs1555399206, rs201778577, rs1555399210, rs1555399214, rs1555399270, rs1555399273, rs1555399281, rs1555399371, rs1555399385, rs1555399477, rs1555399484, rs1555399761, rs1555399775, rs1555399802, rs1555399804, rs1555399837, rs1555399840, rs1555399940, rs1555399944, rs1555399949, rs1555399953, rs1555399954, rs1555399955, rs1555399959, rs1555399962, rs1555399963, rs1060501041, rs1555399974, rs1555399976, rs1555399977, rs1555400049, rs794728172, rs1555400062, rs1555400064, rs1555400066, rs1555400267, rs1555400268, rs1555400278, rs794728168, rs1555400279, rs1156747241, rs1555400288, rs1555400371, rs1555400372, rs1555400379, rs1555400385, rs587782943, rs1555400387, rs1555400406, rs1439533354, rs746201757, rs1555400595, rs1555400603, rs1555400604, rs1555400606, rs1555400609, rs752010116, rs1555400612, rs1555400616, rs1555401004, rs1555401005, rs146348130, rs1555401667, rs1555401671, rs1555401676, rs1555401679, rs1555401687, rs1555401689, rs1555401695, rs1555401697, rs1555401701, rs1555404799, rs1555404800, rs200295020, rs1555404810, rs1555404820, rs1555405031, rs1555405039, rs1555405045, rs1555405530, rs794728292, rs1555405533, rs1555405536, rs1555405537, rs111764111, rs1555405658, rs1555405664, rs774371494, rs1555405673, rs1555407399, rs1555407414, rs1555407423, rs1555407429, rs886041536, rs1555404806, rs1566911709, rs1566913974, rs1566894226, rs1566895223, rs1566897376, rs1566902526, rs1566915277, rs1566897374, rs1566897420, rs1566891655, rs1346043320, rs1566922396, rs1566891706, rs1566894783, rs1566913670, rs1555394196, rs1566891454, rs1566891406, rs1566891404, rs1566895262, rs1566891645, rs1566895225, rs1566896114, rs1566898399, rs1566904011, rs1566906537, rs1566908956, rs1566909766, rs1566919599, rs1566937712, rs1566915335, rs1566891675, rs1566904526, rs1566906506, rs1566900540, rs1566894230, rs1555395206, rs1566891797, rs1597512576, rs1597523873, rs1597581001, rs1597516325, rs1057524757, rs1597506641, rs1597520781, rs1597593695, rs1597529829, rs1597520625, rs1597579923, rs1597531796, rs1008275504, rs1597567249, rs1597569265, rs1597652471, rs1597516347, rs1597577114, rs1597633163, rs1597519658, rs1597593852, rs1597516501, rs1566913982, rs1555393859, rs1597513708, rs368978109, rs1480832655, rs1597520683, rs1597522390, rs1597522553, rs1597529748, rs1597533707, rs1597537815, rs1597545309, rs1597545836, rs1597563234, rs1597563280, rs1597564359, rs772108557, rs1597568968, rs1597574236, rs1597574308, rs1597577975, rs193922179, rs1597581005, rs1597593736, rs1597623670, rs1597625734, rs1597631662, rs113604459, rs1597633183, rs1597633219, rs1597518951, rs1555394781, rs1597525871, rs1597526073, rs1597569159, rs1597569536, rs1597563934, rs1597545199, rs1364210063, rs1597552583, rs1597520619, rs1597540854, rs1597591602, rs1597569551, rs1597548716, rs1597553721, rs112728248, rs1597537858, rs1597517935, rs1597540907, rs1597552388, rs1597591643, rs1597529841, rs1597506547, rs1597509836, rs1597529686, rs1566897404, rs1597533713, rs1597543486, rs1597545257, rs1597545345, rs1597548672, rs1597562812, rs1597563287, rs1597571391, rs1555400052, rs1597583989, rs363852, rs1597547226, rs363808, rs974604498, rs2043595650, rs2043526284, rs2042997306, rs1555397195, rs886039054, rs1555397213, rs2042873946	19602265
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	17728788
Rheumatoid arthritis	Rheumatoid Arthritis, Rheumatoid Arthritis, Systemic Juvenile	rs587776843	16872482

Unknown
Disease term	Disease name	Evidence	References	Source
Mental depression	Endogenous depression, Depressive disorder, Unipolar Depression, Depressive Syndrome, Depression, Neurotic		20177408	ClinVar
Cystic Fibrosis	cystic fibrosis			GenCC

Associations from Text Mining
Disease Name	Relationship Type	References
Acute Coronary Syndrome	Stimulate	14769218, 22693633
Acute Coronary Syndrome	Associate	25105152, 27101443, 31924846
Adenocarcinoma	Associate	15248897, 18820669, 25716200
Adenocarcinoma	Inhibit	18751381
Adenocarcinoma	Stimulate	26530123
Adenocarcinoma of Lung	Associate	17709373, 24932684, 30070326, 37783508, 37784249, 39735553
Alzheimer Disease	Associate	28005991, 28230058, 31611872, 37147668, 38178159
Anemia	Associate	19591577
Anemia Aplastic	Associate	40406144
Aneurysm	Associate	12618703
Aneurysm Ascending Aorta	Associate	37207221
Angina Stable	Associate	25821795
Angina Unstable	Associate	25821795
Angina Unstable	Stimulate	25821795
Anthropophobia	Associate	36298774
Aortic Aneurysm Abdominal	Associate	12618703
Arthritis Juvenile	Associate	11508429, 12355488, 12746913, 15146431, 15498795
Arthritis Rheumatoid	Associate	10446857, 10617637, 11407686, 12528110, 15146413, 16200611, 17456524, 18723565, 19644855, 20471506, 20830230, 21401926, 23402792, 26752645, 27619729, 31701681, 32410863, 33374446, 33610191
Arthritis Rheumatoid	Inhibit	31701681
Arthritis Rheumatoid	Stimulate	39614150
Ascites	Stimulate	18490733
Asthma	Associate	27619729
Atherosclerosis	Associate	18723565, 20727156, 22693633, 24003651, 25105152, 26825917, 27101443, 27230555, 27619729, 29403061, 29482504, 31811089, 31924846, 36094626
Autism Spectrum Disorder	Stimulate	18676531
Autoimmune Diseases	Associate	23028743, 24530749, 27696094, 29186613, 32410863, 33401503
Behcet Syndrome	Associate	29669352
Bile Duct Diseases	Associate	40596471
Bipolar Disorder	Associate	40516077
Bone Diseases	Associate	20471506
Bone Neoplasms	Associate	36496973
Breast Neoplasms	Stimulate	11985788
Breast Neoplasms	Associate	18490711, 19602265, 24939415, 25101674, 26161389, 26852939, 26911617, 27456360, 31978276
Breast Neoplasms	Inhibit	35012533
Calcinosis Cutis	Associate	25168062, 27629595, 34992145
Cap Myopathy	Associate	11920501
Carcinogenesis	Associate	16488898, 22629429, 24356968, 24656654, 24887129, 24939415, 25716200, 26549761, 28323005, 30742638, 31602798, 33327252, 35769782, 37880655
Carcinogenesis	Stimulate	18493321
Carcinoma	Associate	26852939, 28114961
Carcinoma Adenoid Cystic	Stimulate	31096436
Carcinoma Hepatocellular	Associate	15612021, 26474589, 31370326, 38238845
Carcinoma Hepatocellular	Stimulate	34897107
Carcinoma Non Small Cell Lung	Associate	12576459, 22461895, 22988252, 34649152
Carcinoma Ovarian Epithelial	Associate	23551967, 24272203
Carcinoma Pancreatic Ductal	Associate	30226561, 34408923
Carcinoma Renal Cell	Associate	26884830, 33327252
Carcinoma Squamous Cell	Associate	21792010, 31602798, 37485818
Carcinoma Transitional Cell	Associate	15248897
Cardiomyopathies	Associate	22927777
Cartilage Diseases	Associate	24569872
Cell Transformation Neoplastic	Associate	24887129, 24932684
Cerebral Infarction	Stimulate	27884769
Choroidal Effusions	Associate	33469074
Chronobiology Disorders	Associate	28230058
Cognition Disorders	Associate	33407905
Colitis	Associate	33046033
Colitis Ulcerative	Stimulate	12109441
Colitis Ulcerative	Associate	32410863, 33046033
Colorectal Neoplasms	Stimulate	18426738
Colorectal Neoplasms	Associate	24840392, 26352431, 29896883, 32857678, 33779485, 36527118
Communicable Diseases	Associate	20085845, 26752645
Communication Disorders	Associate	19346297
Conversion Disorder	Associate	25503271
Conversion Disorder	Stimulate	27787379
Coronary Artery Disease	Associate	24699314, 26825917, 27101443, 28578664, 33850223, 35964012, 37304261
Coronary Disease	Associate	25821795, 26825917
Coronary Restenosis	Associate	20727156
COVID 19	Associate	37946732, 39940787
Crohn Disease	Associate	32410863, 36833379, 38288119
Cystic Fibrosis	Associate	25503271
Cytokine Release Syndrome	Associate	33850223
Depressive Disorder	Associate	29373661
Depressive Disorder Major	Associate	26171980
Dermatitis Atopic	Associate	27598332, 32410863
Diabetes Mellitus	Associate	35205271
Diabetes Mellitus Type 1	Associate	33401503, 33827531
Diabetes Mellitus Type 2	Associate	27101443, 29213072, 39926598
Diabetic Nephropathies	Stimulate	18842989
Disease	Associate	11531944, 21071513
Drug Fever	Stimulate	27629595
Duodenal Ulcer	Associate	26535701
Dyspepsia	Associate	19685530
Empyema	Stimulate	33469074
Encephalitis Tick Borne	Associate	28646884
Endometrial Hyperplasia	Associate	26985869
Endometrial Neoplasms	Stimulate	25439837
Endometrial Neoplasms	Associate	26985869, 29673664
Endometriosis	Stimulate	12095493, 16616746, 25439837
Endometriosis	Associate	19299454
Esophageal Squamous Cell Carcinoma	Associate	15973102, 23497377, 37091857
Familial Primary Pulmonary Hypertension	Associate	28668810
Fibrosis	Stimulate	27337548
Fibrosis	Associate	31370326
Fibrous Dysplasia Polyostotic	Associate	19220835
Gallbladder Neoplasms	Associate	26530123
Gastritis	Stimulate	16488898
Gastritis	Associate	24656654
Gastritis Atrophic	Associate	20380014
Gastrointestinal Neoplasms	Associate	19318487, 24887129
Gastrointestinal Stromal Tumors	Associate	39464891
Glioblastoma	Associate	12445161, 12507885, 20038293, 37252795
Glioblastoma	Stimulate	19759012
Glioma	Associate	12507885, 19759012
Glomerulonephritis	Associate	10652026, 36329091
Glomerulonephritis Membranous	Associate	36329091
Glomerulosclerosis Focal Segmental	Stimulate	10652026
Goiter	Associate	24667663
Granulomatous Disease Chronic	Associate	10652026
Graves Disease	Associate	24667663
Growth Disorders	Associate	31514750
Guillain Barre Syndrome	Associate	19602265, 29071813
Hearing Loss Sensorineural	Associate	31889466
Heart Defects Congenital	Stimulate	30881226
Heart Diseases	Associate	22693633
Heart Failure	Associate	35964012, 37304261
Hematologic Neoplasms	Associate	25175718
Hematoma	Associate	28282868
Hemoglobinuria Paroxysmal	Associate	28151558
Hemophilia A	Associate	37363971
Hemorrhage	Associate	37363971
Hepatitis Autoimmune	Stimulate	23913513, 27696094
Hepatitis Autoimmune	Associate	23913513, 27696094
Hereditary leiomyomatosis and renal cell cancer	Associate	18070985
HIV Infections	Stimulate	20085845
HIV Infections	Associate	36298774
Hydrocephalus Normal Pressure	Associate	37277809
Hypercholesterolemia	Associate	35205271
Hypergammaglobulinemia	Stimulate	17470266
Hyperkeratosis lenticularis perstans	Stimulate	27787379
Hyperplasia	Associate	12528110
Hypertension Pulmonary	Associate	30881226
Hypertrophy	Associate	35904178
Hypoglycemia	Stimulate	12507885
hypoglycemic encephalopathy	Stimulate	12507885
Hypothyroidism Congenital Nongoitrous 2	Associate	18710704
Hypoxia	Stimulate	12507885, 17609976, 18493321, 20727156
Hypoxia	Associate	19644855, 25188299, 25405996, 31618079
Hypoxia Brain	Stimulate	12507885, 31866994
Hypoxia Brain	Associate	15612021, 18493321
Idiopathic Noncirrhotic Portal Hypertension	Associate	28611261
Idiopathic Pulmonary Fibrosis	Stimulate	27337548
IgA Vasculitis	Associate	10617637, 15146413, 31430067, 32410863
Ige Responsiveness Atopic	Associate	14962818
Immune System Diseases	Associate	15216464
Infections	Inhibit	22615251
Infertility	Associate	12095493, 16616746
Inflammation	Associate	11673308, 11985788, 12109441, 12355488, 12445161, 15216464, 15248897, 15612021, 15968736, 17005573, 17456524, 17906677, 18493321, 19346297, 19602265, 19723024, 20085845, 20460119, 21071513, 22629429, 22693633, 22952837, 23028743, 23771534, 24594996, 24843155, 25101674, 25439837, 25503271, 25716200, 25821795, 26015767, 26352431, 26825917, 27101443, 27392431, 27696094, 27884769, 28282868, 28323005, 29186613, 29239244, 29403061, 29487601, 30009530, 30120767, 30475413, 31370326, 31514750, 31602798, 31611872, 31811089, 31866994, 32427427, 33046033, 33374446, 33401503, 33610191, 34157052, 34363351, 35205271, 35904178, 36094626, 36329091, 36496973, 37207221, 37509065, 37652021, 39348749, 39926598, 39930365, 40406144, 40596471
Inflammation	Stimulate	20397261, 27690673, 29071813
Insulin Resistance	Associate	17906677
Intervertebral Disc Degeneration	Associate	30511959, 38492610
Intervertebral Disc Displacement	Associate	30511959
Intestinal Diseases	Stimulate	16488898
Joint Diseases	Associate	16200611
Kidney Diseases	Associate	10652026, 26895959
Kidney Diseases	Stimulate	36329091
Kidney Failure Chronic	Stimulate	24471420
Kidney Failure Chronic	Associate	31514750, 35205271
Larva Migrans	Stimulate	38111581
Leukemia Lymphocytic Chronic B Cell	Associate	36323260
Leukemia Myeloid Acute	Associate	40406144
Lewy Body Disease	Stimulate	37147668
Liver Cirrhosis	Associate	31370326
Liver Cirrhosis Biliary	Stimulate	23913513, 40596471
Liver Cirrhosis Biliary	Associate	23913513
Liver Diseases	Associate	23913513, 31370326
Liver Diseases	Stimulate	33469074
Liver Failure	Associate	23721694
Lumbar Stenosis Familial	Associate	35904178
Lung Neoplasms	Stimulate	12576459
Lung Neoplasms	Associate	19131591
Lupus Erythematosus Discoid	Associate	33401503
Lupus Erythematosus Systemic	Associate	22127710, 22551315, 24530749, 27619729, 30009530, 31379847, 33134397
Lupus Erythematosus Systemic	Stimulate	24530749, 27230555
Lupus Nephritis	Stimulate	10652026
Lupus Nephritis	Associate	30787934
Lymphatic Metastasis	Stimulate	22611320, 24396292, 24887129, 26379396, 31602798
Lymphatic Metastasis	Associate	25716200, 34157052
Lymphoma Large B Cell Diffuse	Associate	39376717
Lymphoma Non Hodgkin	Associate	8043869
Lymphoma T Cell Cutaneous	Associate	3295063
Malaria	Associate	20702656
Melanoma	Stimulate	25168062
Melanoma	Associate	31069878, 33344042
Meningioma	Associate	23372434, 24098347, 37880655
Meningism	Associate	21208809
Meningitis Bacterial	Associate	33407905
Meningitis Pneumococcal	Associate	21208809, 33407905
Mental Disorders	Associate	29373661
Mesothelioma Malignant	Associate	24594996
Mouth Diseases	Inhibit	25637622
Multiple Organ Failure	Stimulate	17245183
Multiple Sclerosis	Associate	20233515, 30140701, 30160778, 31581595, 33401503
Muscular dystrophy congenital with central nervous system involvement	Associate	22127710
Myelodysplastic Syndromes	Associate	40406144
Nasal Polyps	Associate	23771534
Nasopharyngeal Carcinoma	Associate	18570662, 22893706, 24396292
Nasopharyngeal Carcinoma	Stimulate	29807404, 32578505
Necrosis	Associate	12507885, 20397261
Neoplasm Invasiveness	Stimulate	26530123
Neoplasm Metastasis	Associate	18490733, 18563508, 26352431, 26852939, 30226561, 34157052, 34992145
Neoplasms	Associate	11985788, 12445161, 12576459, 14739336, 15248897, 15612021, 15968736, 15973102, 16002723, 16948864, 18490733, 18493321, 18502749, 18563508, 18570662, 18751381, 19131591, 19723024, 19759012, 19915866, 20038293, 20495367, 21792010, 22893706, 23372434, 23409183, 23497377, 24272203, 24356968, 24396292, 24594996, 24887129, 25175718, 25716200, 26107210, 26352431, 26379396, 26530123, 26852939, 26911617, 27619729, 27629595, 29186613, 30024813, 30226561, 31069878, 31811089, 31978276, 33401503, 34157052, 34408923, 34724273, 35509079, 35523772, 35769782, 36496973, 37335089, 37355993, 37485818, 37649598, 37880655, 38052787, 38095640, 38191424, 39464891
Neoplasms	Stimulate	19602265, 24939415, 25168062, 28323005, 30742638, 31602798, 34416845
Nephritis	Associate	22127710
Nephrolithiasis	Associate	26895959
Nephrotic Syndrome	Associate	31422388
Neuroblastoma	Associate	14739336, 37611092
Neurodegenerative Diseases	Associate	34724273
Neuroinflammatory Diseases	Associate	31611872
Niemann Pick Disease Type C	Associate	22893706
Non alcoholic Fatty Liver Disease	Associate	38238845
Non alcoholic Fatty Liver Disease	Stimulate	39583964
Obesity	Associate	23975165, 25972622
Obesity	Stimulate	29737494
Osteoarthritis	Inhibit	33610191
Osteoarthritis	Associate	36685529
Osteoporosis	Associate	20471506
Osteosarcoma	Associate	18563508, 25101674
Ovarian Neoplasms	Stimulate	18490733
Ovarian Neoplasms	Associate	19915866, 26719579
Pain	Associate	16616746
Pancreatic Neoplasms	Associate	30226561
Pancreatitis	Associate	17245183, 20397261
Pancreatitis Acute Necrotizing	Associate	17245183
Parasitemia	Associate	20702656
Pelvic Pain	Associate	16616746
Periapical Periodontitis	Associate	32427427
Personality Disorders	Associate	37611092
Plaque Atherosclerotic	Associate	24003651, 30506423, 33850223
Pneumococcal Infections	Associate	21208809
Pneumonia	Associate	20811626
Poikiloderma with Neutropenia	Stimulate	17245183
Polycystic Kidney Autosomal Dominant	Associate	38052787
Polycystic Ovary Syndrome	Inhibit	25446648
Polymyositis	Associate	29239244
Polyps	Associate	23771534
Prader Willi Syndrome	Associate	37430349
Pre Eclampsia	Stimulate	22007254
Precancerous Conditions	Associate	21792010, 40171814
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	28898234
Premature Birth	Associate	33356032
Prostate cancer familial	Associate	29095436
Prostatic Hyperplasia	Stimulate	33148606
Prostatic Neoplasms	Stimulate	16000172, 34157052
Prostatic Neoplasms	Associate	30120767, 36452480
Prostatitis	Associate	11920501
Pulmonary Arterial Hypertension	Associate	28668810, 39930365
Pulmonary Disease Chronic Obstructive	Associate	33046825
Purpura Thrombocytopenic Idiopathic	Associate	36326455
Renal Insufficiency	Associate	31514750
Respiratory Distress Syndrome In Premature Infants	Stimulate	33356032
Respiratory Distress Syndrome Newborn	Associate	33356032
Retinal Detachment	Stimulate	26015767, 32542038
Retinal Detachment	Associate	33371882
Retinal Necrosis Syndrome Acute	Stimulate	28395298
Retinal Perforations	Associate	33430811
Retinal Vein Occlusion	Associate	28611261, 31814701
Rhabdoid Tumor Predisposition Syndrome 1	Associate	37726478
Rhabdomyosarcoma	Stimulate	27629595
Rhegmatogenous Retinal Detachment Autosomal Dominant	Stimulate	26015767
Rupture	Stimulate	22693633
Sarcoidosis	Associate	19220835
Sarcoma	Associate	16948864, 24167613
Schizophrenia	Inhibit	39940697
Scleroderma Diffuse	Associate	28668810
Scleroderma Systemic	Associate	28668810
Sepsis	Associate	19346297
Serositis	Associate	22127710
Severe Acute Respiratory Syndrome	Associate	19591577
Sezary Syndrome	Associate	3295063
Sjogren's Syndrome	Stimulate	17470266
Skin Diseases	Associate	29723363
Sleep Apnea Obstructive	Stimulate	22451332
Spondylitis Ankylosing	Associate	33610191
Squamous Cell Carcinoma of Head and Neck	Inhibit	26549761
Squamous Cell Carcinoma of Head and Neck	Stimulate	34416845
Squamous Cell Carcinoma of Head and Neck	Associate	37272017
Still's Disease Adult Onset	Associate	23721694
Still's Disease Adult Onset	Stimulate	39376199
Stomach Diseases	Associate	16488898
Stomach Diseases	Stimulate	19685530
Stomach Neoplasms	Associate	15968736, 16488898, 19550422, 19685530, 19938192, 20380014, 22611320, 24379579, 24887129, 26379396, 30238562, 30804389, 37649598
Stomach Neoplasms	Stimulate	38319150
Stroke	Associate	27884769
Subarachnoid Hemorrhage	Associate	38173028
Syndrome	Stimulate	34129019
Synovitis	Associate	36685529
Tachycardia Atrioventricular Nodal Reentry	Associate	11985788
Telangiectasis	Associate	34129019
Thrombosis	Associate	33850223, 36094626
Thyroid Cancer Papillary	Associate	26206776
Thyroid Neoplasms	Associate	26206776
Tuberculosis	Associate	29809055
Tuberculosis Pulmonary	Stimulate	29071813
Tuberculosis Pulmonary	Associate	29809055, 32525926
Tuberculosis Spinal	Associate	32791730
Urinary Bladder Neoplasms	Associate	15248897
Uterine Cervical Neoplasms	Stimulate	19915866
Uterine Diseases	Associate	18710704, 19299454
Uveal melanoma	Associate	32957329, 34992145
Uveitis	Associate	11673308
Vasospasm Intracranial	Associate	31595394
Vitiligo	Associate	24667663, 29723363, 32705792
Weight Loss	Inhibit	18356846
West Nile Fever	Stimulate	26638028
White Coat Hypertension	Stimulate	31581595