Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4256
Gene name Gene Name - the full gene name approved by the HGNC.
Matrix Gla protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MGP
Synonyms (NCBI Gene) Gene synonyms aliases
GIG36, MGLAP, NTI
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12p12.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the osteocalcin/matrix Gla family of proteins. The encoded vitamin K-dependent protein is secreted by chondrocytes and vascular smooth muscle cells, and functions as a physiological inhibitor of ectopic tissue calcification.
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs111320759 C>T Pathogenic-likely-pathogenic, pathogenic Splice donor variant
rs112518413 T>A,C Pathogenic Splice acceptor variant
rs730880321 C>- Pathogenic Coding sequence variant, stop gained
rs730880322 A>G,T Pathogenic Coding sequence variant, stop gained, synonymous variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017975 hsa-miR-335-5p Microarray 18185580
MIRT029487 hsa-miR-26b-5p Microarray 19088304
MIRT1147531 hsa-miR-1273f CLIP-seq
MIRT1147532 hsa-miR-1303 CLIP-seq
MIRT1147533 hsa-miR-135a CLIP-seq
Transcription factors
Transcription factor Regulation Reference
JUN Unknown 11425864
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001502 Process Cartilage condensation TAS 9916809
GO:0001503 Process Ossification IEA
GO:0005201 Function Extracellular matrix structural constituent RCA 20551380, 23979707, 27068509, 27559042
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 15607035
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
154870 7060 ENSG00000111341
Protein
UniProt ID P08493
Protein name Matrix Gla protein (MGP) (Cell growth-inhibiting gene 36 protein)
Protein function Associates with the organic matrix of bone and cartilage. Thought to act as an inhibitor of bone formation.
Family and domains
Sequence
MKSLILLAILAALAVVTLCYESHESMESYELNPFINRRNANTFISPQQRWRAKVQERIRE
RSKPVHELNREACDDYRLCERYAMVYGYNAAYNRYFRKRRGTK
Sequence length 103
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Carcinoma Carcinoma, Carcinoma, Spindle-Cell, Undifferentiated carcinoma rs121912654, rs555607708, rs786202962, rs1564055259 16316942, 12376462
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291
View all (32 more)
Hypertension Hypertensive disease rs13306026
Keutel syndrome Keutel syndrome rs730880321, rs112518413, rs730880322, rs111320759 15810001, 21705322, 9916809
Unknown
Disease term Disease name Evidence References Source
Otitis media Recurrent otitis media ClinVar
Associations from Text Mining
Disease Name Relationship Type References
AA amyloidosis Associate 38343068
Abnormalities Drug Induced Associate 21724703
Acute Kidney Injury Associate 26981580
Aortic Valve Calcification of Associate 25990696
Aortic Valve Calcification of Inhibit 29653899
Aortic Valve Stenosis Associate 29653899
Astrocytoma Associate 12937144
Atherosclerosis Associate 15864013, 21143859, 23307874
beta Thalassemia Associate 23899606
Bone Diseases Associate 25354236