Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	4255
Gene name	O-6-methylguanine-DNA methyltransferase
Gene symbol	MGMT
Synonyms (NCBI Gene)	-
Chromosome	10
Chromosome location	10q26.3
Summary	Alkylating agents are potent carcinogens that can result in cell death, mutation and cancer. The protein encoded by this gene is a DNA repair protein that is involved in cellular defense against mutagenesis and toxicity from alkylating agents. The protein

Show/Hide all (45)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006937	hsa-miR-181d-5p	Luciferase reporter assayqRT-PCRWestern blot	22570426
MIRT006937	hsa-miR-181d-5p	Luciferase reporter assayqRT-PCRWestern blot	22570426
MIRT438835	hsa-miR-661	Luciferase reporter assay	23340988
MIRT438835	hsa-miR-661	Luciferase reporter assay	23340988
MIRT438833	hsa-miR-370-3p	Luciferase reporter assay	23340988
MIRT438833	hsa-miR-370-3p	Luciferase reporter assay	23340988
MIRT006937	hsa-miR-181d-5p	Luciferase reporter assay	23340988
MIRT006937	hsa-miR-181d-5p	Luciferase reporter assay	23340988
MIRT438830	hsa-miR-767-3p	Luciferase reporter assay	23340988
MIRT438830	hsa-miR-767-3p	Luciferase reporter assay	23340988
MIRT438827	hsa-miR-648	Luciferase reporter assay	23340988
MIRT438827	hsa-miR-648	Luciferase reporter assay	23340988
MIRT438295	hsa-miR-222-3p	Luciferase reporter assayWestern blot	24147153
MIRT438295	hsa-miR-222-3p	Luciferase reporter assayWestern blot	24147153
MIRT438294	hsa-miR-221-3p	Luciferase reporter assayWestern blot	24147153
MIRT438294	hsa-miR-221-3p	Luciferase reporter assayWestern blot	24147153
MIRT438835	hsa-miR-661	Luciferase reporter assay	23340988
MIRT438835	hsa-miR-661	Luciferase reporter assay	23340988
MIRT438833	hsa-miR-370-3p	Luciferase reporter assay	23340988
MIRT438833	hsa-miR-370-3p	Luciferase reporter assay	23340988
MIRT006937	hsa-miR-181d-5p	Luciferase reporter assay	23340988
MIRT006937	hsa-miR-181d-5p	Luciferase reporter assay	23340988
MIRT438830	hsa-miR-767-3p	Luciferase reporter assay	23340988
MIRT438830	hsa-miR-767-3p	Luciferase reporter assay	23340988
MIRT438827	hsa-miR-648	Luciferase reporter assay	23340988
MIRT438827	hsa-miR-648	Luciferase reporter assay	23340988
MIRT438295	hsa-miR-222-3p	Luciferase reporter assayWestern blot	24147153
MIRT438295	hsa-miR-222-3p	Luciferase reporter assayWestern blot	24147153
MIRT438294	hsa-miR-221-3p	Luciferase reporter assayWestern blot	24147153
MIRT438294	hsa-miR-221-3p	Luciferase reporter assayWestern blot	24147153
MIRT438833	hsa-miR-370-3p	Luciferase reporter assayWestern blot	27595933
MIRT438833	hsa-miR-370-3p	Luciferase reporter assayWestern blot	27595933
MIRT006937	hsa-miR-181d-5p	MicroarrayqRT-PCRWestern blot	27057640
MIRT438295	hsa-miR-222-3p	Luciferase reporter assayqRT-PCRImmunofluorescenceFlow cytometry	36319884
MIRT1147525	hsa-miR-3127-3p	CLIP-seq
MIRT1147526	hsa-miR-3661	CLIP-seq
MIRT1147527	hsa-miR-4276	CLIP-seq
MIRT1147528	hsa-miR-4786-5p	CLIP-seq
MIRT1147529	hsa-miR-631	CLIP-seq
MIRT1147530	hsa-miR-769-5p	CLIP-seq
MIRT2041975	hsa-miR-374c	CLIP-seq
MIRT2041976	hsa-miR-4746-3p	CLIP-seq
MIRT2041977	hsa-miR-655	CLIP-seq
MIRT2041975	hsa-miR-374c	CLIP-seq
MIRT2041977	hsa-miR-655	CLIP-seq

Show/Hide all (11)

Transcription factor	Regulation	Reference
DNMT1	Unknown	18555750
EP300	Unknown	22675172
HDAC1	Unknown	18555750
JUN	Unknown	9731508
MBD1	Repression	15657354
MECP2	Unknown	15657354
NFKB1	Unknown	22675172
RELA	Unknown	22675172
SP1	Unknown	22675172
TP53	Repression	17564708;19846904
TP53	Unknown	20525765

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	2188979
GO:0003824	Function	Catalytic activity	IEA
GO:0003908	Function	Methylated-DNA-[protein]-cysteine S-methyltransferase activity	IBA
GO:0003908	Function	Methylated-DNA-[protein]-cysteine S-methyltransferase activity	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	2188979
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006281	Process	DNA repair	IBA
GO:0006281	Process	DNA repair	IEA
GO:0006281	Process	DNA repair	IEA
GO:0006307	Process	DNA alkylation repair	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0008168	Function	Methyltransferase activity	IEA
GO:0008168	Function	Methyltransferase activity	TAS	2188979
GO:0009008	Function	DNA-methyltransferase activity	TAS	2405387
GO:0016020	Component	Membrane	HDA	19946888
GO:0016740	Function	Transferase activity	IEA
GO:0032259	Process	Methylation	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IDA	24147153
GO:0046872	Function	Metal ion binding	IEA
GO:2000781	Process	Positive regulation of double-strand break repair	IDA	24147153

MIM	HGNC	e!Ensembl
156569	7059	ENSG00000170430

P16455

Protein name

Methylated-DNA--protein-cysteine methyltransferase (EC 2.1.1.63) (6-O-methylguanine-DNA methyltransferase) (MGMT) (O-6-methylguanine-DNA-alkyltransferase)

Protein function

Involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) and O4-methylthymine (O4-MeT) in DNA. Repairs the methylated nucleobase in DNA by stoichiometrically transferring the methyl group to a cysteine residue

PDB

1EH6 , 1EH7 , 1EH8 , 1QNT , 1T38 , 1T39 , 1YFH , 8RGG , 8RGH , 8RTY , 8RU2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02870	Methyltransf_1N	6 → 90	6-O-methylguanine DNA methyltransferase, ribonuclease-like domain	Domain
PF01035	DNA_binding_1	93 → 174	6-O-methylguanine DNA methyltransferase, DNA binding domain	Domain

Sequence

MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLM
QCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAAL
AGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPG
LGGSSGLAGAWLKGAGATSGSPPAGRN

Sequence length

207

Interactions

View interactions

	Reactome
			MGMT-mediated DNA damage reversal

MGMT (O-6-methylguanine-DNA methyltransferase)