Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4241
Gene name Gene Name - the full gene name approved by the HGNC.	Melanotransferrin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MELTF
Synonyms (NCBI Gene) Gene synonyms aliases	CD228, MAP97, MFI2, MTF1, MTf
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3q29
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a cell-surface glycoprotein found on melanoma cells. The protein shares sequence similarity and iron-binding properties with members of the transferrin superfamily. The importance of the iron binding function has not ye

Show/Hide all(14)

miRTarBase ID	miRNA	Experiments	Reference
MIRT490254	hsa-miR-3940-3p	PAR-CLIP	23592263
MIRT490253	hsa-miR-6499-5p	PAR-CLIP	23592263
MIRT490252	hsa-miR-3960	PAR-CLIP	23592263
MIRT490250	hsa-miR-8072	PAR-CLIP	23592263
MIRT490251	hsa-miR-4767	PAR-CLIP	23592263
MIRT490249	hsa-miR-744-5p	PAR-CLIP	23592263
MIRT490248	hsa-miR-671-5p	PAR-CLIP	23592263
MIRT490247	hsa-miR-1273a	PAR-CLIP	23592263
MIRT490245	hsa-miR-4467	PAR-CLIP	23592263
MIRT490246	hsa-miR-3180	PAR-CLIP	23592263
MIRT490244	hsa-miR-3180-3p	PAR-CLIP	23592263
MIRT490243	hsa-miR-3196	PAR-CLIP	23592263
MIRT490242	hsa-miR-6816-5p	PAR-CLIP	23592263
MIRT490241	hsa-miR-4750-5p	PAR-CLIP	23592263

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
FOS	Unknown	8836133
JUN	Unknown	8836133

Show/Hide all(28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001558	Process	Regulation of cell growth	IMP	7556058
GO:0005506	Function	Iron ion binding	IMP	7556058
GO:0005506	Function	Iron ion binding	TAS	2419904
GO:0005515	Function	Protein binding	IPI	19815549, 25416956, 29924966, 32296183, 35156780
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005769	Component	Early endosome	IBA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	7556058
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006826	Process	Iron ion transport	IBA
GO:0006826	Process	Iron ion transport	IEA
GO:0006826	Process	Iron ion transport	IMP	7556058
GO:0009986	Component	Cell surface	IDA	7556058
GO:0010756	Process	Positive regulation of plasminogen activation	IDA	16713448
GO:0016020	Component	Membrane	IEA
GO:0042127	Process	Regulation of cell population proliferation	IMP	7556058
GO:0046872	Function	Metal ion binding	IEA
GO:0055037	Component	Recycling endosome	IBA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 20458337, 23533145
GO:0090091	Process	Positive regulation of extracellular matrix disassembly	IDA	16713448
GO:0098552	Component	Side of membrane	IEA
GO:1900025	Process	Negative regulation of substrate adhesion-dependent cell spreading	IDA	16713448

MIM	HGNC	e!Ensembl
155750	7037	ENSG00000163975

Protein

UniProt ID

P08582

Protein name

Melanotransferrin (Melanoma-associated antigen p97) (CD antigen CD228)

Protein function

Involved in iron cellular uptake. Seems to be internalized and then recycled back to the cell membrane. Binds a single atom of iron per subunit. Could also bind zinc.

PDB

6XR0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00405	Transferrin	23 → 357	Transferrin	Domain
PF00405	Transferrin	366 → 706	Transferrin	Domain

Tissue specificity

TISSUE SPECIFICITY: Found predominantly in human melanomas and in certain fetal tissues; also found in liver, epithelium, umbilical chord, placenta and sweat gland ducts.

Sequence

MRGPSGALWLLLALRTVLGGMEVRWCATSDPEQHKCGNMSEAFREAGIQPSLLCVRGTSA
DHCVQLIAAQEADAITLDGGAIYEAGKEHGLKPVVGEVYDQEVGTSYYAVAVVRRSSHVT
IDTLKGVKSCHTGINRTVGWNVPVGYLVESGRLSVMGCDVLKAVSDYFGGSCVPGAGETS
YSESLCRLCRGDSSGEGVCDKSPLERYYDYSGAFRCLAEGAGDVAFVKHSTVLENTDGKT
LPSWGQALLSQDFELLCRDGSRADVTEWRQCHLARVPAHAVVVRADTDGGLIFRLLNEGQ
RLFSHEGSSFQMFSSEAYGQKDLLFKDSTSELVPIATQTYEAWLGHEYLHAMKGLLCDPN
RLPPYLRWCVLSTPEIQKCGDMAVAFRRQRLKPEIQCVSAKSPQHCMERIQAEQVDAVTL
SGEDIYTAGKTYGLVPAAGEHYAPEDSSNSYYVVAVVRRDSSHAFTLDELRGKRSCHAGF
GSPAGWDVPVGALIQRGFIRPKDCDVLTAVSEFFNASCVPVNNPKNYPSSLCALCVGDEQ
GRNKCVGNSQERYYGYRGAFRCLVENAGDVAFVRHTTVFDNTNGHNSEPWAAELRSEDYE
LLCPNGARAEVSQFAACNLAQIPPHAVMVRPDTNIFTVYGLLDKAQDLFGDDHNKNGFKM
FDSSNYHGQDLLFKDATVRAVPVGEKTTYRGWLGLDYVAALEGMSSQQCSGAAAPAPGAP
LLPLLLPALAARLLPPAL

Sequence length

738

Interactions

View interactions

	Reactome
			Post-translational modification: synthesis of GPI-anchored proteins Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) Post-translational protein phosphorylation

MELTF (melanotransferrin)