Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4240
Gene name Gene Name - the full gene name approved by the HGNC.	Milk fat globule EGF and factor V/VIII domain containing
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MFGE8
Synonyms (NCBI Gene) Gene synonyms aliases	BA46, EDIL1, HMFG, HsT19888, MFG-E8, MFGM, OAcGD3S, SED1, SPAG10, hP47
Chromosome Chromosome number	15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	15q26.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a preproprotein that is proteolytically processed to form multiple protein products. The major encoded protein product, lactadherin, is a membrane glycoprotein that promotes phagocytosis of apoptotic cells. This protein has also been imp

Show/Hide all(74)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017018	hsa-miR-335-5p	Microarray	18185580
MIRT038170	hsa-miR-423-5p	CLASH	23622248
MIRT1551273	hsa-miR-1	CLIP-seq
MIRT1551274	hsa-miR-1207-5p	CLIP-seq
MIRT1551275	hsa-miR-185	CLIP-seq
MIRT1551276	hsa-miR-206	CLIP-seq
MIRT1551277	hsa-miR-3184	CLIP-seq
MIRT1551278	hsa-miR-3661	CLIP-seq
MIRT1551279	hsa-miR-3665	CLIP-seq
MIRT1551280	hsa-miR-4306	CLIP-seq
MIRT1551281	hsa-miR-4489	CLIP-seq
MIRT1551282	hsa-miR-4644	CLIP-seq
MIRT1551283	hsa-miR-4651	CLIP-seq
MIRT1551284	hsa-miR-4736	CLIP-seq
MIRT1551285	hsa-miR-4763-3p	CLIP-seq
MIRT1551286	hsa-miR-608	CLIP-seq
MIRT1551287	hsa-miR-613	CLIP-seq
MIRT1551288	hsa-miR-631	CLIP-seq
MIRT1551289	hsa-miR-637	CLIP-seq
MIRT1551290	hsa-miR-7	CLIP-seq
MIRT1551283	hsa-miR-4651	CLIP-seq
MIRT1551286	hsa-miR-608	CLIP-seq
MIRT1551289	hsa-miR-637	CLIP-seq
MIRT1551274	hsa-miR-1207-5p	CLIP-seq
MIRT2570290	hsa-miR-1224-5p	CLIP-seq
MIRT2570291	hsa-miR-148a	CLIP-seq
MIRT2570292	hsa-miR-148b	CLIP-seq
MIRT2570293	hsa-miR-152	CLIP-seq
MIRT2570294	hsa-miR-3074-5p	CLIP-seq
MIRT2570295	hsa-miR-3124-3p	CLIP-seq
MIRT2570296	hsa-miR-3157-3p	CLIP-seq
MIRT2570297	hsa-miR-3169	CLIP-seq
MIRT2570298	hsa-miR-3191	CLIP-seq
MIRT2570299	hsa-miR-4278	CLIP-seq
MIRT2570300	hsa-miR-4330	CLIP-seq
MIRT2570301	hsa-miR-4421	CLIP-seq
MIRT2570302	hsa-miR-4436a	CLIP-seq
MIRT2570303	hsa-miR-4515	CLIP-seq
MIRT2570304	hsa-miR-4700-3p	CLIP-seq
MIRT2570305	hsa-miR-4751	CLIP-seq
MIRT1551285	hsa-miR-4763-3p	CLIP-seq
MIRT2570306	hsa-miR-510	CLIP-seq
MIRT2570307	hsa-miR-512-5p	CLIP-seq
MIRT2570308	hsa-miR-515-3p	CLIP-seq
MIRT2570309	hsa-miR-519e	CLIP-seq
MIRT2570310	hsa-miR-570	CLIP-seq
MIRT1551289	hsa-miR-637	CLIP-seq
MIRT2570311	hsa-miR-874	CLIP-seq
MIRT2570312	hsa-miR-938	CLIP-seq
MIRT1551274	hsa-miR-1207-5p	CLIP-seq
MIRT2570290	hsa-miR-1224-5p	CLIP-seq
MIRT2570291	hsa-miR-148a	CLIP-seq
MIRT2570292	hsa-miR-148b	CLIP-seq
MIRT2570293	hsa-miR-152	CLIP-seq
MIRT2570294	hsa-miR-3074-5p	CLIP-seq
MIRT2570295	hsa-miR-3124-3p	CLIP-seq
MIRT2570296	hsa-miR-3157-3p	CLIP-seq
MIRT2570297	hsa-miR-3169	CLIP-seq
MIRT2570299	hsa-miR-4278	CLIP-seq
MIRT2570300	hsa-miR-4330	CLIP-seq
MIRT2570301	hsa-miR-4421	CLIP-seq
MIRT2570302	hsa-miR-4436a	CLIP-seq
MIRT2570303	hsa-miR-4515	CLIP-seq
MIRT2570304	hsa-miR-4700-3p	CLIP-seq
MIRT2570305	hsa-miR-4751	CLIP-seq
MIRT1551285	hsa-miR-4763-3p	CLIP-seq
MIRT2570306	hsa-miR-510	CLIP-seq
MIRT2570307	hsa-miR-512-5p	CLIP-seq
MIRT2570308	hsa-miR-515-3p	CLIP-seq
MIRT2570309	hsa-miR-519e	CLIP-seq
MIRT2570310	hsa-miR-570	CLIP-seq
MIRT1551289	hsa-miR-637	CLIP-seq
MIRT2570311	hsa-miR-874	CLIP-seq
MIRT2570312	hsa-miR-938	CLIP-seq

Show/Hide all(23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001786	Function	Phosphatidylserine binding	IBA
GO:0001786	Function	Phosphatidylserine binding	IPI	21196491
GO:0002080	Component	Acrosomal membrane	IEA
GO:0005178	Function	Integrin binding	IEA
GO:0005201	Function	Extracellular matrix structural constituent	RCA	20551380, 27068509, 27559042, 28327460
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0007155	Process	Cell adhesion	IEA
GO:0007338	Process	Single fertilization	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0031012	Component	Extracellular matrix	HDA	20551380
GO:0031012	Component	Extracellular matrix	HDA	27068509, 27559042, 28327460
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0043277	Process	Apoptotic cell clearance	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 20458337, 21362503
GO:1903561	Component	Extracellular vesicle	HDA	24769233

MIM	HGNC	e!Ensembl
602281	7036	ENSG00000140545

Protein

UniProt ID

Q08431

Protein name

Lactadherin (Breast epithelial antigen BA46) (HMFG) (MFGM) (Milk fat globule-EGF factor 8) (MFG-E8) (SED1) [Cleaved into: Lactadherin short form; Medin]

Protein function

Plays an important role in the maintenance of intestinal epithelial homeostasis and the promotion of mucosal healing. Promotes VEGF-dependent neovascularization (By similarity). Contributes to phagocytic removal of apoptotic cells in many tissue

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00008	EGF	27 → 65	EGF-like domain	Domain
PF00754	F5_F8_type_C	85 → 222	F5/8 type C domain	Domain
PF00754	F5_F8_type_C	245 → 384	F5/8 type C domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Mammary epithelial cell surfaces and aortic media. Overexpressed in several carcinomas.

Sequence

MPRPRLLAALCGALLCAPSLLVALDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKG
YAGNHCETKCVEPLGLENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPS
SNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHK
EFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNS
IPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVT
GIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFET
PILARYVRILPVAWHNRIALRLELLGC

Sequence length

387

Interactions

View interactions

	KEGG		Reactome
	Efferocytosis		Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) Post-translational protein phosphorylation Amyloid fiber formation

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Giant Cell Arteritis	Giant cell arteritis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (62)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
AA amyloidosis	Associate	24602872, 25614623, 36433666
Acute Lung Injury	Inhibit	25936372, 37774691
Alopecia	Associate	31811237
Alzheimer Disease	Associate	25614623, 37914766
Aortic Aneurysm Abdominal	Associate	22797469
Arthritis Infectious	Associate	23324439
Ascites	Associate	36484512
Atherosclerosis	Associate	30861420
Brain Ischemia	Associate	35005020
Breast Neoplasms	Associate	37704733
Carcinogenesis	Stimulate	36484512
Carcinoma Ductal Breast	Associate	37975220
Carcinoma Ovarian Epithelial	Associate	31899997
Carcinoma Pancreatic Ductal	Associate	33893076
Carcinoma Squamous Cell	Associate	25264705
Carotid Artery Diseases	Associate	35440618
Colitis Ulcerative	Inhibit	22204000
Colorectal Neoplasms	Associate	25081869
Colorectal Neoplasms	Stimulate	28653875
Coronary Artery Disease	Associate	30861420
Coronary Disease	Inhibit	40413414
COVID 19	Associate	37643521
Dementia Vascular	Associate	37914766
Diabetes Mellitus Type 2	Stimulate	37933040
Diabetic Nephropathies	Inhibit	37933040
Endometrial Neoplasms	Associate	36659830
Endometriosis	Associate	28967712
Fibrosis	Associate	23324439
Glycogen Storage Disease Type IV	Inhibit	26375445
Hereditary Breast and Ovarian Cancer Syndrome	Associate	36484512
Infertility	Associate	28967712
Inflammation	Associate	22204000, 23324439
Inflammation	Inhibit	37774691
Inflammation	Stimulate	37914766
Kidney Diseases	Associate	31811237
Kidney Diseases	Inhibit	37933040
Liver Diseases	Associate	40140823
Lupus Erythematosus Systemic	Associate	31811237
Lymphatic Metastasis	Associate	28653875
Median Neuropathy	Associate	31210552
Mucopolysaccharidosis I	Associate	32880920
Neoplasm Metastasis	Associate	28653875, 36659830
Neoplasm Metastasis	Stimulate	38431242
Neoplasms	Associate	24505114, 25081869, 25264705, 28653875, 31256324, 32591639, 37450593, 38431242
Neuroinflammatory Diseases	Associate	39361088
Ovarian Neoplasms	Associate	20132413, 31899997
Ovarian Neoplasms	Stimulate	36484512
Pain	Associate	23324439
Pancreatic Neoplasms	Associate	38431242
Pancreatitis Chronic	Stimulate	23324439
Pulmonary Disease Chronic Obstructive	Inhibit	26375445
Pulmonary Disease Chronic Obstructive	Associate	30100715
Sarcoma	Associate	26055407
Sarcopenia	Associate	38644354
Sepsis	Associate	37774691
Squamous Cell Carcinoma of Head and Neck	Associate	25264705, 31256324
Subarachnoid Hemorrhage	Associate	35005020, 36267465
Takotsubo Cardiomyopathy	Associate	32695227
Thyroid Cancer Papillary	Associate	34814333
Trigeminal Neuralgia	Associate	39361088
Triple Negative Breast Neoplasms	Associate	32591639
Vascular Calcification	Stimulate	35440618

MFGE8 (milk fat globule EGF and factor V/VIII domain containing)