Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4234
Gene name Gene Name - the full gene name approved by the HGNC.	Methyltransferase 1, tRNA methylguanosine
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	METTL1
Synonyms (NCBI Gene) Gene synonyms aliases	C12orf1, TRM8, TRMT8, YDL201w
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12q14.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is similar in sequence to the S. cerevisiae YDL201w gene. The gene product contains a conserved S-adenosylmethionine-binding motif and is inactivated by phosphorylation. Alternative splice variants encoding different protein isoforms have been d

Show/Hide all(77)

miRTarBase ID	miRNA	Experiments	Reference
MIRT656307	hsa-miR-136-5p	HITS-CLIP	23824327
MIRT656306	hsa-miR-1277-3p	HITS-CLIP	23824327
MIRT656305	hsa-miR-885-5p	HITS-CLIP	23824327
MIRT656303	hsa-miR-1470	HITS-CLIP	23824327
MIRT656304	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT656302	hsa-miR-204-3p	HITS-CLIP	23824327
MIRT656301	hsa-miR-4646-5p	HITS-CLIP	23824327
MIRT656300	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT656299	hsa-miR-3153	HITS-CLIP	23824327
MIRT656298	hsa-miR-6733-5p	HITS-CLIP	23824327
MIRT656296	hsa-miR-6739-5p	HITS-CLIP	23824327
MIRT656297	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT656295	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT461485	hsa-miR-3910	PAR-CLIP	23592263
MIRT461484	hsa-miR-3154	PAR-CLIP	23592263
MIRT461483	hsa-miR-2392	PAR-CLIP	23592263
MIRT461482	hsa-miR-4459	PAR-CLIP	23592263
MIRT461481	hsa-miR-605-3p	PAR-CLIP	23592263
MIRT461480	hsa-miR-5004-5p	PAR-CLIP	23592263
MIRT461479	hsa-miR-3605-5p	PAR-CLIP	23592263
MIRT461478	hsa-miR-6894-5p	PAR-CLIP	23592263
MIRT461477	hsa-miR-1193	PAR-CLIP	23592263
MIRT461476	hsa-miR-4650-3p	PAR-CLIP	23592263
MIRT461475	hsa-miR-3529-5p	PAR-CLIP	23592263
MIRT461474	hsa-miR-379-5p	PAR-CLIP	23592263
MIRT461473	hsa-miR-4451	PAR-CLIP	23592263
MIRT461472	hsa-miR-4298	PAR-CLIP	23592263
MIRT656307	hsa-miR-136-5p	HITS-CLIP	23824327
MIRT656306	hsa-miR-1277-3p	HITS-CLIP	23824327
MIRT656305	hsa-miR-885-5p	HITS-CLIP	23824327
MIRT656303	hsa-miR-1470	HITS-CLIP	23824327
MIRT656304	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT656302	hsa-miR-204-3p	HITS-CLIP	23824327
MIRT656301	hsa-miR-4646-5p	HITS-CLIP	23824327
MIRT656300	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT656299	hsa-miR-3153	HITS-CLIP	23824327
MIRT656298	hsa-miR-6733-5p	HITS-CLIP	23824327
MIRT656296	hsa-miR-6739-5p	HITS-CLIP	23824327
MIRT656297	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT656295	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT461485	hsa-miR-3910	PAR-CLIP	23592263
MIRT461484	hsa-miR-3154	PAR-CLIP	23592263
MIRT461483	hsa-miR-2392	PAR-CLIP	23592263
MIRT461482	hsa-miR-4459	PAR-CLIP	23592263
MIRT461481	hsa-miR-605-3p	PAR-CLIP	23592263
MIRT461480	hsa-miR-5004-5p	PAR-CLIP	23592263
MIRT461479	hsa-miR-3605-5p	PAR-CLIP	23592263
MIRT461478	hsa-miR-6894-5p	PAR-CLIP	23592263
MIRT461477	hsa-miR-1193	PAR-CLIP	23592263
MIRT461476	hsa-miR-4650-3p	PAR-CLIP	23592263
MIRT461475	hsa-miR-3529-5p	PAR-CLIP	23592263
MIRT461474	hsa-miR-379-5p	PAR-CLIP	23592263
MIRT461473	hsa-miR-4451	PAR-CLIP	23592263
MIRT461472	hsa-miR-4298	PAR-CLIP	23592263
MIRT1143754	hsa-miR-1285	CLIP-seq
MIRT1143755	hsa-miR-146b-3p	CLIP-seq
MIRT1143756	hsa-miR-1913	CLIP-seq
MIRT1143757	hsa-miR-1976	CLIP-seq
MIRT1143758	hsa-miR-3173-5p	CLIP-seq
MIRT1143759	hsa-miR-3187-5p	CLIP-seq
MIRT1143760	hsa-miR-324-3p	CLIP-seq
MIRT1143761	hsa-miR-3591-3p	CLIP-seq
MIRT1143762	hsa-miR-370	CLIP-seq
MIRT1143763	hsa-miR-4292	CLIP-seq
MIRT1143764	hsa-miR-4684-5p	CLIP-seq
MIRT1143765	hsa-miR-4727-5p	CLIP-seq
MIRT1143766	hsa-miR-4768-5p	CLIP-seq
MIRT1143767	hsa-miR-612	CLIP-seq
MIRT1143768	hsa-miR-874	CLIP-seq
MIRT2040904	hsa-miR-1915	CLIP-seq
MIRT2040905	hsa-miR-330-3p	CLIP-seq
MIRT2040906	hsa-miR-3667-5p	CLIP-seq
MIRT2040907	hsa-miR-4661-3p	CLIP-seq
MIRT2040908	hsa-miR-4726-3p	CLIP-seq
MIRT2040909	hsa-miR-4733-5p	CLIP-seq
MIRT2040910	hsa-miR-4747-5p	CLIP-seq
MIRT2040911	hsa-miR-7	CLIP-seq

Show/Hide all(32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000049	Function	TRNA binding	IEA
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	15861136, 16189514, 25416956, 26751069, 31515488, 32296183, 33961781
GO:0005634	Component	Nucleus	IDA	15861136
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006400	Process	TRNA modification	IDA	12403464, 15861136
GO:0006400	Process	TRNA modification	IEA
GO:0008033	Process	TRNA processing	IEA
GO:0008168	Function	Methyltransferase activity	IEA
GO:0008176	Function	TRNA (guanine(46)-N7)-methyltransferase activity	IBA
GO:0008176	Function	TRNA (guanine(46)-N7)-methyltransferase activity	IDA	12403464, 15861136, 36599982, 36599985, 37369656
GO:0008176	Function	TRNA (guanine(46)-N7)-methyltransferase activity	IEA
GO:0008298	Process	Intracellular mRNA localization	IDA	37379838
GO:0016740	Function	Transferase activity	IEA
GO:0030488	Process	TRNA methylation	IBA
GO:0032259	Process	Methylation	IEA
GO:0033554	Process	Cellular response to stress	IDA	37379838
GO:0034063	Process	Stress granule assembly	IDA	32302570, 32302571
GO:0036265	Process	RNA (guanine-N7)-methylation	IBA
GO:0036265	Process	RNA (guanine-N7)-methylation	IDA	37379838
GO:0036416	Process	TRNA stabilization	IDA	36599982, 36599985
GO:0043527	Component	TRNA methyltransferase complex	IBA
GO:0051028	Process	MRNA transport	IDA	37379838
GO:0106004	Process	TRNA (guanine-N7)-methylation	IDA	36599982, 36599985, 37369656
GO:0106004	Process	TRNA (guanine-N7)-methylation	IEA
GO:0106143	Component	TRNA (m7G46) methyltransferase complex	IDA	36599982, 36599985
GO:0106143	Component	TRNA (m7G46) methyltransferase complex	IEA
GO:0160090	Function	Internal mRNA (guanine-N7-)-methyltransferase activity	IDA	31031084, 37379838
GO:0160090	Function	Internal mRNA (guanine-N7-)-methyltransferase activity	IEA

MIM	HGNC	e!Ensembl
604466	7030	ENSG00000037897

Protein

UniProt ID

Q9UBP6

Protein name

tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (Methyltransferase-like protein 1) (mRNA (guanine-N(7)-)-methyltransferase) (EC 2.1.1.-) (miRNA (guanine-N(7)-)-methyltransferase) (EC 2.1.1.-) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-m

Protein function

Catalytic component of METTL1-WDR4 methyltransferase complex that mediates the formation of N(7)-methylguanine in a subset of RNA species, such as tRNAs, mRNAs and microRNAs (miRNAs) (PubMed:12403464, PubMed:31031083, PubMed:31031084, PubMed:365

PDB

3CKK , 7OGJ , 7PL1 , 7U20 , 8CTH , 8CTI , 8D58 , 8D59 , 8D5B , 8D9K , 8D9L , 8EG0 , 8H0N

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02390	Methyltransf_4	76 → 254	Putative methyltransferase	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:10329009}.

Sequence

MAAETRNVAGAEAPPPQKRYYRQRAHSNPMADHTLRYPVKPEEMDWSELYPEFFAPLTQN
QSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRI
RALRAAPAGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTL
LAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEE
GKKVLRNGGKNFPAIFRRIQDPVLQAVTSQTSLPGH

Sequence length

276

Interactions

View interactions

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Gastric Cancer	Gastric cancer	Furthermore, GC cells growth was significantly inhibited after the down-regulation of METTL1 in vitro and in vivo.	35177812	CBGDA
Multiple Sclerosis	Multiple sclerosis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (24)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	37116150
Ameloblastoma	Associate	38309318
Breast Neoplasms	Associate	40683927
Carcinogenesis	Associate	36599985, 36733406, 37516825
Carcinoma Hepatocellular	Associate	36661684, 37528384
Cataract Congenital Nuclear Autosomal Recessive 2	Associate	36599982
Central Nervous System Vascular Malformations	Associate	36599982
Colorectal Neoplasms	Inhibit	31866582
Colorectal Neoplasms	Associate	32135185
Epilepsy	Associate	40658715
Esophageal Squamous Cell Carcinoma	Associate	35574843
Glioma	Associate	36733406
Inflammation	Associate	37516825
Lung Neoplasms	Associate	34371184
Melanoma Cutaneous Malignant	Associate	35771136
Multiple Sclerosis	Associate	23160276
Neoplasms	Associate	31866582, 34285249, 34416137, 36599985, 36635678, 37516825, 39198433, 39216043, 39369912, 40683927
Neoplasms	Inhibit	32135185
Neoplasms	Stimulate	34352207
Ovarian Neoplasms	Associate	36545327
Prostatic Neoplasms	Associate	37516825, 37599359
Prostatic Neoplasms Castration Resistant	Stimulate	37599359
Stomach Neoplasms	Associate	33589575, 37863651
Urinary Bladder Neoplasms	Associate	34936728

METTL1 (methyltransferase 1, tRNA methylguanosine)