Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4233
Gene name	MET proto-oncogene, receptor tyrosine kinase
Gene symbol	MET
Synonyms (NCBI Gene)	AUTS9DA11DFNB97HGFRRCCP2c-Met
Chromosome	7
Chromosome location	7q31.2
Summary	This gene encodes a member of the receptor tyrosine kinase family of proteins and the product of the proto-oncogene MET. The encoded preproprotein is proteolytically processed to generate alpha and beta subunits that are linked via disulfide bonds to form

Show/Hide all (37)

SNP ID	Visualize variation	Clinical significance	Consequence
rs34589476	C>T	Likely-pathogenic, conflicting-interpretations-of-pathogenicity, likely-benign	Non coding transcript variant, missense variant, genic downstream transcript variant, coding sequence variant
rs35776110	C>T	Conflicting-interpretations-of-pathogenicity, likely-benign, benign-likely-benign	Non coding transcript variant, genic upstream transcript variant, missense variant, intron variant, coding sequence variant
rs45520237	C>T	Conflicting-interpretations-of-pathogenicity, likely-benign	Non coding transcript variant, synonymous variant, coding sequence variant
rs56311081	C>A,T	Conflicting-interpretations-of-pathogenicity, likely-benign	Non coding transcript variant, stop gained, genic upstream transcript variant, missense variant, intron variant, coding sequence variant
rs56391007	C>T	Uncertain-significance, conflicting-interpretations-of-pathogenicity, likely-pathogenic, benign-likely-benign	Non coding transcript variant, missense variant, genic downstream transcript variant, coding sequence variant
rs121913243	A>C,G	Pathogenic, likely-pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs121913244	C>T	Likely-pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs121913245	T>C	Likely-pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs121913246	A>G	Pathogenic, likely-pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs121913247	T>C	Uncertain-significance, likely-pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs121913668	T>C	Pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs121913669	G>A,T	Uncertain-significance, pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs121913670	G>A	Pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs121913671	G>A,C	Pathogenic, likely-pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs121913673	C>G,T	Uncertain-significance, pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs121913675	C>T	Pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs121913676	G>A,C,T	Pathogenic, likely-pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs121913677	A>G	Pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs180985111	G>A	Not-provided, conflicting-interpretations-of-pathogenicity, likely-benign	Non coding transcript variant, intron variant, missense variant, coding sequence variant, genic upstream transcript variant
rs200074800	G>A,T	Not-provided, conflicting-interpretations-of-pathogenicity, likely-benign	Intron variant, non coding transcript variant, missense variant, coding sequence variant, genic upstream transcript variant
rs200740468	G>A,C	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Missense variant, coding sequence variant, non coding transcript variant
rs200861145	T>A	Conflicting-interpretations-of-pathogenicity, likely-benign	Intron variant, non coding transcript variant, missense variant, coding sequence variant, genic upstream transcript variant
rs201274041	G>A,T	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Intron variant, non coding transcript variant, missense variant, coding sequence variant, genic upstream transcript variant
rs398123568	C>G	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Non coding transcript variant, missense variant, coding sequence variant
rs398123569	C>T	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Non coding transcript variant, genic downstream transcript variant, missense variant, coding sequence variant
rs398123570	G>C	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Non coding transcript variant, genic downstream transcript variant, missense variant, coding sequence variant
rs587780736	C>-,CC	Conflicting-interpretations-of-pathogenicity, likely-benign	Intron variant
rs772860611	C>T	Conflicting-interpretations-of-pathogenicity, likely-benign	Coding sequence variant, genic downstream transcript variant, non coding transcript variant, synonymous variant
rs776014448	A>G	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, genic upstream transcript variant, intron variant, non coding transcript variant, missense variant
rs786202724	G>A	Pathogenic, likely-pathogenic	Coding sequence variant, non coding transcript variant, genic downstream transcript variant, missense variant
rs794728016	T>G	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs869320706	GAGCTACTTTTCCAGAAGGTATATTTC>-	Risk-factor	Intron variant, genic downstream transcript variant, splice donor variant, coding sequence variant, non coding transcript variant
rs869320707	G>T	Risk-factor	Genic downstream transcript variant, splice donor variant
rs1057519824	T>G	Likely-pathogenic	Non coding transcript variant, genic downstream transcript variant, coding sequence variant, missense variant
rs1057520030	A>G,T	Likely-pathogenic	Non coding transcript variant, genic downstream transcript variant, coding sequence variant, missense variant
rs1554400286	A>G	Risk-factor	Genic downstream transcript variant, coding sequence variant, missense variant, non coding transcript variant
rs1584941533	T>C	Conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant, non coding transcript variant

637

Show/Hide all (637)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001969	hsa-miR-199a-3p	Luciferase reporter assayWestern blot	18456660
MIRT004292	hsa-miR-23b-3p	Luciferase reporter assayqRT-PCRWestern blot	19490101
MIRT004292	hsa-miR-23b-3p	Luciferase reporter assayqRT-PCRWestern blot	19490101
MIRT004292	hsa-miR-23b-3p	Luciferase reporter assayqRT-PCRWestern blot	19490101
MIRT004292	hsa-miR-23b-3p	Luciferase reporter assayqRT-PCRWestern blot	19490101
MIRT001357	hsa-miR-1-3p	Luciferase reporter assayWestern blot	18818206
MIRT001357	hsa-miR-1-3p	Luciferase reporter assayWestern blot	18818206
MIRT000759	hsa-miR-34a-5p	ReviewLuciferase reporter assay	19461653
MIRT000758	hsa-miR-34b-5p	ReviewLuciferase reporter assay	19461653
MIRT000757	hsa-miR-34c-5p	ReviewLuciferase reporter assay	19461653
MIRT000757	hsa-miR-34c-5p	ReviewLuciferase reporter assay	19461653
MIRT000758	hsa-miR-34b-5p	ReviewLuciferase reporter assay	19461653
MIRT000759	hsa-miR-34a-5p	ReviewLuciferase reporter assay	19461653
MIRT000759	hsa-miR-34a-5p	Luciferase reporter assayWestern blotNorthern blot	19029026
MIRT000759	hsa-miR-34a-5p	Luciferase reporter assayWestern blotNorthern blot	19029026
MIRT000759	hsa-miR-34a-5p	qRT-PCRWestern blot	20309880
MIRT000185	hsa-miR-206	qRT-PCRChIPLuciferase reporter assayWestern blotNorthern blot	20388878
MIRT001357	hsa-miR-1-3p	Luciferase reporter assay	18818206
MIRT001969	hsa-miR-199a-3p	Luciferase reporter assay	18456660
MIRT000759	hsa-miR-34a-5p	Luciferase reporter assay	19029026
MIRT000759	hsa-miR-34a-5p	Luciferase reporter assay	18834857
MIRT000757	hsa-miR-34c-5p	Luciferase reporter assay	20198305
MIRT004825	hsa-miR-34b-3p	MicroarrayWestern blotRTPCR	20924086
MIRT000757	hsa-miR-34c-5p	MicroarrayWestern blotRTPCR	20924086
MIRT001357	hsa-miR-1-3p	Luciferase reporter assayWestern blot	18593903
MIRT005024	hsa-miR-562	Luciferase reporter assay	19789318
MIRT005167	hsa-miR-30a-5p	pSILAC	18668040
MIRT001357	hsa-miR-1-3p	pSILAC	18668040
MIRT000759	hsa-miR-34a-5p	Luciferase reporter assayqRT-PCRWestern blot	19773441
MIRT000759	hsa-miR-34a-5p	Luciferase reporter assayqRT-PCRWestern blot	19773441
MIRT000759	hsa-miR-34a-5p	qRT-PCRWestern blot	19006648
MIRT001357	hsa-miR-1-3p	Luciferase reporter assayWestern blot	19710019
MIRT001357	hsa-miR-1-3p	Luciferase reporter assayWestern blot	19710019
MIRT000185	hsa-miR-206	Luciferase reporter assayWestern blot	19710019
MIRT000185	hsa-miR-206	Luciferase reporter assayWestern blot	19710019
MIRT000185	hsa-miR-206	Western blot	19620785
MIRT005458	hsa-miR-340-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	21692045
MIRT001357	hsa-miR-1-3p	qRT-PCR	21169019
MIRT000759	hsa-miR-34a-5p	Luciferase reporter assayqRT-PCRWestern blot	22457788
MIRT004825	hsa-miR-34b-3p	Luciferase reporter assay	22419847
MIRT004825	hsa-miR-34b-3p	Luciferase reporter assay	22419847
MIRT004825	hsa-miR-34b-3p	Luciferase reporter assay	22419847
MIRT004825	hsa-miR-34b-3p	Luciferase reporter assay	22419847
MIRT000757	hsa-miR-34c-5p	Luciferase reporter assay	22419847
MIRT000757	hsa-miR-34c-5p	Luciferase reporter assay	22419847
MIRT000757	hsa-miR-34c-5p	Luciferase reporter assay	22419847
MIRT000757	hsa-miR-34c-5p	Luciferase reporter assay	22419847
MIRT006346	hsa-miR-449a	Luciferase reporter assayWestern blot	21418558
MIRT006351	hsa-miR-449b-5p	Luciferase reporter assayWestern blot	21418558
MIRT000759	hsa-miR-34a-5p	Luciferase reporter assayqRT-PCRWestern blot	22457788
MIRT004825	hsa-miR-34b-3p	Luciferase reporter assay	22419847
MIRT004825	hsa-miR-34b-3p	Luciferase reporter assay	22419847
MIRT004825	hsa-miR-34b-3p	Luciferase reporter assay	22419847
MIRT004825	hsa-miR-34b-3p	Luciferase reporter assay	22419847
MIRT000757	hsa-miR-34c-5p	Luciferase reporter assay	22419847
MIRT000757	hsa-miR-34c-5p	Luciferase reporter assay	22419847
MIRT006346	hsa-miR-449a	Luciferase reporter assayWestern blot	21418558
MIRT006351	hsa-miR-449b-5p	Luciferase reporter assayWestern blot	21418558
MIRT000759	hsa-miR-34a-5p	Luciferase reporter assayqRT-PCRWestern blot	22457788
MIRT004825	hsa-miR-34b-3p	Luciferase reporter assay	22419847
MIRT004825	hsa-miR-34b-3p	Luciferase reporter assay	22419847
MIRT004825	hsa-miR-34b-3p	Luciferase reporter assay	22419847
MIRT004825	hsa-miR-34b-3p	Luciferase reporter assay	22419847
MIRT000757	hsa-miR-34c-5p	Luciferase reporter assay	22419847
MIRT000757	hsa-miR-34c-5p	Luciferase reporter assay	22419847
MIRT006346	hsa-miR-449a	Luciferase reporter assayWestern blot	21418558
MIRT006351	hsa-miR-449b-5p	Luciferase reporter assayWestern blot	21418558
MIRT000759	hsa-miR-34a-5p	Luciferase reporter assay	22159222
MIRT000759	hsa-miR-34a-5p	Luciferase reporter assay	22159222
MIRT006778	hsa-miR-198	Luciferase reporter assayqRT-PCRWestern blot	21658389
MIRT006778	hsa-miR-198	Luciferase reporter assayqRT-PCRWestern blot	21658389
MIRT006778	hsa-miR-198	Luciferase reporter assayqRT-PCRWestern blot	21658389
MIRT006778	hsa-miR-198	Luciferase reporter assayqRT-PCRWestern blot	21658389
MIRT007137	hsa-miR-130a-3p	qRT-PCR	23418453
MIRT016691	hsa-miR-133b	Reporter assay	20505319
MIRT001539	hsa-miR-155-5p	Other	18668040
MIRT004292	hsa-miR-23b-3p	Reporter assay;Western blot;qRT-PCR	19490101
MIRT001357	hsa-miR-1-3p	Proteomics	18668040
MIRT001357	hsa-miR-1-3p	Microarray	18668037
MIRT000759	hsa-miR-34a-5p	qRT-PCR	21240262
MIRT005167	hsa-miR-30a-5p	Proteomics;Other	18668040
MIRT035528	hsa-miR-31-5p	Luciferase reporter assay	23552883
MIRT035528	hsa-miR-31-5p	Luciferase reporter assay	23553486
MIRT044529	hsa-miR-320a	CLASH	23622248
MIRT035879	hsa-miR-1303	CLASH	23622248
MIRT053148	hsa-miR-27a-3p	Luciferase reporter assayqRT-PCRWestern blot	23650389
MIRT053148	hsa-miR-27a-3p	Luciferase reporter assayqRT-PCRWestern blot	23650389
MIRT053225	hsa-miR-137	Luciferase reporter assayqRT-PCRWestern blot	23151846
MIRT053225	hsa-miR-137	Luciferase reporter assayqRT-PCRWestern blot	23151846
MIRT035528	hsa-miR-31-5p	ImmunoblotImmunohistochemistryLuciferase reporter assayqRT-PCR	22948084
MIRT054232	hsa-miR-410-3p	Luciferase reporter assayqRT-PCRWestern blot	22750473
MIRT054388	hsa-miR-148a-3p	ImmunoblotImmunofluorescenceImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	24013226
MIRT054388	hsa-miR-148a-3p	ImmunoblotImmunofluorescenceImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	24013226
MIRT006346	hsa-miR-449a	Luciferase reporter assayWestern BlotqRT-PCR	23734217
MIRT001969	hsa-miR-199a-3p	ImmunofluorescenceMicroarrayQRTPCRWestern blot	24810336
MIRT437442	hsa-miR-409-3p	Luciferase reporter assayqRT-PCRWestern blot	23820886
MIRT437442	hsa-miR-409-3p	Luciferase reporter assayqRT-PCRWestern blot	23820886
MIRT000759	hsa-miR-34a-5p	5.0	24983493
MIRT437858	hsa-miR-101-3p	Luciferase reporter assayWestern blot	23618864
MIRT437858	hsa-miR-101-3p	Luciferase reporter assayWestern blot	23618864
MIRT000759	hsa-miR-34a-5p	ImmunofluorescenceqRT-PCRWestern blot	23970470
MIRT438442	hsa-miR-7515	Luciferase reporter assayqRT-PCRWestern blot	23087254
MIRT001357	hsa-miR-1-3p	MicroarrayqRT-PCRWestern blot	25874496
MIRT438343	hsa-miR-144-3p	ChIP-seqLuciferase reporter assayMicroarrayqRT-PCRWestern blot	25927670
MIRT438343	hsa-miR-144-3p	ChIP-seqLuciferase reporter assayMicroarrayqRT-PCRWestern blot	25927670
MIRT000757	hsa-miR-34c-5p	Luciferase reporter assay	23922103
MIRT016691	hsa-miR-133b	Western blot	24391788
MIRT000759	hsa-miR-34a-5p	ImmunofluorescenceqRT-PCRWestern blot	23970470
MIRT438442	hsa-miR-7515	Luciferase reporter assayqRT-PCRWestern blot	23087254
MIRT001357	hsa-miR-1-3p	MicroarrayqRT-PCRWestern blot	25874496
MIRT438343	hsa-miR-144-3p	ChIP-seqLuciferase reporter assayMicroarrayqRT-PCRWestern blot	25927670
MIRT438343	hsa-miR-144-3p	ChIP-seqLuciferase reporter assayMicroarrayqRT-PCRWestern blot	25927670
MIRT000757	hsa-miR-34c-5p	Luciferase reporter assay	23922103
MIRT016691	hsa-miR-133b	Western blot	24391788
MIRT440251	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440251	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT004292	hsa-miR-23b-3p	qRT-PCRLuciferase reporter assayWestern blot	25405368
MIRT004292	hsa-miR-23b-3p	qRT-PCRLuciferase reporter assayWestern blot	25405368
MIRT004292	hsa-miR-23b-3p	qRT-PCRLuciferase reporter assayWestern blot	25405368
MIRT004292	hsa-miR-23b-3p	qRT-PCRLuciferase reporter assayWestern blot	25405368
MIRT731338	hsa-miR-433-3p	Luciferase reporter assay	26844702
MIRT731338	hsa-miR-433-3p	Luciferase reporter assay	26844702
MIRT001969	hsa-miR-199a-3p	Luciferase reporter assayqRT-PCRWestern blot	26051997
MIRT000759	hsa-miR-34a-5p	FlowImmunofluorescenceIn situ hybridizationqRT-PCRWestern blot	26313360
MIRT319319	hsa-miR-449c-5p	Luciferase reporter assayqRT-PCRWestern blot	26141986
MIRT319319	hsa-miR-449c-5p	Luciferase reporter assayqRT-PCRWestern blot	26141986
MIRT000185	hsa-miR-206	FACSFlowImmunohistochemistryqRT-PCRWestern blot	26186594
MIRT000759	hsa-miR-34a-5p	ImmunohistochemistryqRT-PCRWestern blot	26238271
MIRT000759	hsa-miR-34a-5p	ImmunohistochemistryqRT-PCRWestern blot	26238271
MIRT000759	hsa-miR-34a-5p	ImmunohistochemistryqRT-PCRWestern blot	26238271
MIRT732083	hsa-miR-139-5p	ImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blot	26497851
MIRT732083	hsa-miR-139-5p	ImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blot	26497851
MIRT000759	hsa-miR-34a-5p	FlowLuciferase reporter assayqRT-PCRWestern blot	27513895
MIRT000759	hsa-miR-34a-5p	FlowLuciferase reporter assayqRT-PCRWestern blot	27513895
MIRT004292	hsa-miR-23b-3p	Luciferase reporter assayqRT-PCRWestern blot	28077801
MIRT000757	hsa-miR-34c-5p	Next Generation Sequencing (NGS)qRT-PCRWestern blot	26795575
MIRT000757	hsa-miR-34c-5p	Next Generation Sequencing (NGS)qRT-PCRWestern blot	26795575
MIRT000759	hsa-miR-34a-5p	ImmunoblotqRT-PCR	28250026
MIRT001969	hsa-miR-199a-3p	RMUG-S"	25839163
MIRT438343	hsa-miR-144-3p	Luciferase reporter assayqRT-PCRWestern blot	26250785
MIRT006346	hsa-miR-449a	Luciferase reporter assayqRT-PCRWestern blot	26471185
MIRT001357	hsa-miR-1-3p	Luciferase reporter assayqRT-PCRWestern blot	27247259
MIRT732632	hsa-miR-203a-3p	ImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blotting	34147083
MIRT004825	hsa-miR-34b-3p	Western blottingMicroarrayImmunohistochemistry (IHC)qRT-PCR	33300049
MIRT755947	hsa-miR-128-3p	Luciferase reporter assayWestern blottingqRT-PCR	35252056
MIRT756301	hsa-miR-181a-3p	Luciferase reporter assay	38030594
MIRT1143383	hsa-miR-1	CLIP-seq
MIRT1143384	hsa-miR-1207-3p	CLIP-seq
MIRT1143385	hsa-miR-1264	CLIP-seq
MIRT1143386	hsa-miR-1271	CLIP-seq
MIRT1143387	hsa-miR-1283	CLIP-seq
MIRT1143388	hsa-miR-1284	CLIP-seq
MIRT1143389	hsa-miR-1293	CLIP-seq
MIRT1143390	hsa-miR-130a	CLIP-seq
MIRT1143391	hsa-miR-130b	CLIP-seq
MIRT1143392	hsa-miR-182	CLIP-seq
MIRT1143393	hsa-miR-186	CLIP-seq
MIRT1143394	hsa-miR-2054	CLIP-seq
MIRT1143395	hsa-miR-300	CLIP-seq
MIRT1143396	hsa-miR-301a	CLIP-seq
MIRT1143397	hsa-miR-301b	CLIP-seq
MIRT1143398	hsa-miR-302f	CLIP-seq
MIRT1143399	hsa-miR-31	CLIP-seq
MIRT1143400	hsa-miR-3122	CLIP-seq
MIRT1143401	hsa-miR-3130-3p	CLIP-seq
MIRT1143402	hsa-miR-3143	CLIP-seq
MIRT1143403	hsa-miR-3182	CLIP-seq
MIRT1143404	hsa-miR-3188	CLIP-seq
MIRT1143405	hsa-miR-3192	CLIP-seq
MIRT1143406	hsa-miR-335	CLIP-seq
MIRT1143407	hsa-miR-337-3p	CLIP-seq
MIRT1143408	hsa-miR-3613-3p	CLIP-seq
MIRT1143409	hsa-miR-361-5p	CLIP-seq
MIRT1143410	hsa-miR-3666	CLIP-seq
MIRT1143411	hsa-miR-3689a-3p	CLIP-seq
MIRT1143412	hsa-miR-3689c	CLIP-seq
MIRT1143413	hsa-miR-3689d	CLIP-seq
MIRT1143414	hsa-miR-369-3p	CLIP-seq
MIRT1143415	hsa-miR-371-5p	CLIP-seq
MIRT1143416	hsa-miR-371b-5p	CLIP-seq
MIRT1143417	hsa-miR-374a	CLIP-seq
MIRT1143418	hsa-miR-374b	CLIP-seq
MIRT1143419	hsa-miR-381	CLIP-seq
MIRT1143420	hsa-miR-3913-5p	CLIP-seq
MIRT1143421	hsa-miR-3919	CLIP-seq
MIRT1143422	hsa-miR-3929	CLIP-seq
MIRT1143423	hsa-miR-4277	CLIP-seq
MIRT1143424	hsa-miR-4282	CLIP-seq
MIRT1143425	hsa-miR-4295	CLIP-seq
MIRT1143426	hsa-miR-4419b	CLIP-seq
MIRT1143427	hsa-miR-4421	CLIP-seq
MIRT1143428	hsa-miR-4470	CLIP-seq
MIRT1143429	hsa-miR-4478	CLIP-seq
MIRT1143430	hsa-miR-4483	CLIP-seq
MIRT1143431	hsa-miR-4490	CLIP-seq
MIRT1143432	hsa-miR-454	CLIP-seq
MIRT1143433	hsa-miR-4666-3p	CLIP-seq
MIRT1143434	hsa-miR-4671-3p	CLIP-seq
MIRT1143435	hsa-miR-4684-5p	CLIP-seq
MIRT1143436	hsa-miR-4711-3p	CLIP-seq
MIRT1143437	hsa-miR-4728-5p	CLIP-seq
MIRT1143438	hsa-miR-4756-3p	CLIP-seq
MIRT1143439	hsa-miR-4774-5p	CLIP-seq
MIRT1143440	hsa-miR-4793-3p	CLIP-seq
MIRT1143441	hsa-miR-4796-5p	CLIP-seq
MIRT1143442	hsa-miR-4797-5p	CLIP-seq
MIRT1143443	hsa-miR-4803	CLIP-seq
MIRT1143444	hsa-miR-485-5p	CLIP-seq
MIRT1143445	hsa-miR-495	CLIP-seq
MIRT1143446	hsa-miR-500a	CLIP-seq
MIRT1143447	hsa-miR-502-5p	CLIP-seq
MIRT1143448	hsa-miR-581	CLIP-seq
MIRT1143449	hsa-miR-592	CLIP-seq
MIRT1143450	hsa-miR-593	CLIP-seq
MIRT1143451	hsa-miR-599	CLIP-seq
MIRT1143452	hsa-miR-613	CLIP-seq
MIRT1143453	hsa-miR-633	CLIP-seq
MIRT1143454	hsa-miR-661	CLIP-seq
MIRT1143455	hsa-miR-759	CLIP-seq
MIRT1143456	hsa-miR-96	CLIP-seq
MIRT1143457	hsa-miR-128	CLIP-seq
MIRT1143458	hsa-miR-1290	CLIP-seq
MIRT1143389	hsa-miR-1293	CLIP-seq
MIRT1143390	hsa-miR-130a	CLIP-seq
MIRT1143391	hsa-miR-130b	CLIP-seq
MIRT1143459	hsa-miR-148a	CLIP-seq
MIRT1143460	hsa-miR-148b	CLIP-seq
MIRT1143461	hsa-miR-152	CLIP-seq
MIRT1143462	hsa-miR-2113	CLIP-seq
MIRT1143463	hsa-miR-27a	CLIP-seq
MIRT1143464	hsa-miR-27b	CLIP-seq
MIRT1143395	hsa-miR-300	CLIP-seq
MIRT1143396	hsa-miR-301a	CLIP-seq
MIRT1143397	hsa-miR-301b	CLIP-seq
MIRT1143400	hsa-miR-3122	CLIP-seq
MIRT1143402	hsa-miR-3143	CLIP-seq
MIRT1143465	hsa-miR-3165	CLIP-seq
MIRT1143466	hsa-miR-3167	CLIP-seq
MIRT1143404	hsa-miR-3188	CLIP-seq
MIRT1143405	hsa-miR-3192	CLIP-seq
MIRT1143467	hsa-miR-323-3p	CLIP-seq
MIRT1143407	hsa-miR-337-3p	CLIP-seq
MIRT1143409	hsa-miR-361-5p	CLIP-seq
MIRT1143468	hsa-miR-3662	CLIP-seq
MIRT1143410	hsa-miR-3666	CLIP-seq
MIRT1143411	hsa-miR-3689a-3p	CLIP-seq
MIRT1143412	hsa-miR-3689c	CLIP-seq
MIRT1143413	hsa-miR-3689d	CLIP-seq
MIRT1143414	hsa-miR-369-3p	CLIP-seq
MIRT1143417	hsa-miR-374a	CLIP-seq
MIRT1143418	hsa-miR-374b	CLIP-seq
MIRT1143419	hsa-miR-381	CLIP-seq
MIRT1143420	hsa-miR-3913-5p	CLIP-seq
MIRT1143422	hsa-miR-3929	CLIP-seq
MIRT1143469	hsa-miR-4263	CLIP-seq
MIRT1143424	hsa-miR-4282	CLIP-seq
MIRT1143425	hsa-miR-4295	CLIP-seq
MIRT1143426	hsa-miR-4419b	CLIP-seq
MIRT1143470	hsa-miR-4446-3p	CLIP-seq
MIRT1143471	hsa-miR-4474-3p	CLIP-seq
MIRT1143429	hsa-miR-4478	CLIP-seq
MIRT1143430	hsa-miR-4483	CLIP-seq
MIRT1143472	hsa-miR-4486	CLIP-seq
MIRT1143473	hsa-miR-4492	CLIP-seq
MIRT1143474	hsa-miR-4498	CLIP-seq
MIRT1143475	hsa-miR-4505	CLIP-seq
MIRT1143432	hsa-miR-454	CLIP-seq
MIRT1143433	hsa-miR-4666-3p	CLIP-seq
MIRT1143434	hsa-miR-4671-3p	CLIP-seq
MIRT1143476	hsa-miR-4712-5p	CLIP-seq
MIRT1143437	hsa-miR-4728-5p	CLIP-seq
MIRT1143477	hsa-miR-4799-5p	CLIP-seq
MIRT1143443	hsa-miR-4803	CLIP-seq
MIRT1143444	hsa-miR-485-5p	CLIP-seq
MIRT1143478	hsa-miR-513a-5p	CLIP-seq
MIRT1143479	hsa-miR-526b	CLIP-seq
MIRT1143480	hsa-miR-576-5p	CLIP-seq
MIRT1143481	hsa-miR-578	CLIP-seq
MIRT1143453	hsa-miR-633	CLIP-seq
MIRT1143454	hsa-miR-661	CLIP-seq
MIRT1143482	hsa-miR-762	CLIP-seq
MIRT1143483	hsa-miR-770-5p	CLIP-seq
MIRT1143484	hsa-miR-876-5p	CLIP-seq
MIRT2040796	hsa-miR-1205	CLIP-seq
MIRT2040797	hsa-miR-1206	CLIP-seq
MIRT2040798	hsa-miR-1228	CLIP-seq
MIRT2040799	hsa-miR-1267	CLIP-seq
MIRT1143387	hsa-miR-1283	CLIP-seq
MIRT1143389	hsa-miR-1293	CLIP-seq
MIRT2040800	hsa-miR-181a	CLIP-seq
MIRT2040801	hsa-miR-181b	CLIP-seq
MIRT2040802	hsa-miR-181c	CLIP-seq
MIRT2040803	hsa-miR-181d	CLIP-seq
MIRT2040804	hsa-miR-2052	CLIP-seq
MIRT1143462	hsa-miR-2113	CLIP-seq
MIRT2040805	hsa-miR-2114	CLIP-seq
MIRT2040806	hsa-miR-2117	CLIP-seq
MIRT2040807	hsa-miR-23a	CLIP-seq
MIRT2040808	hsa-miR-23b	CLIP-seq
MIRT2040809	hsa-miR-23c	CLIP-seq
MIRT2040810	hsa-miR-24	CLIP-seq
MIRT2040811	hsa-miR-2682	CLIP-seq
MIRT1143395	hsa-miR-300	CLIP-seq
MIRT1143398	hsa-miR-302f	CLIP-seq
MIRT2040812	hsa-miR-3121-3p	CLIP-seq
MIRT1143400	hsa-miR-3122	CLIP-seq
MIRT1143402	hsa-miR-3143	CLIP-seq
MIRT1143465	hsa-miR-3165	CLIP-seq
MIRT1143403	hsa-miR-3182	CLIP-seq
MIRT1143404	hsa-miR-3188	CLIP-seq
MIRT1143405	hsa-miR-3192	CLIP-seq
MIRT1143467	hsa-miR-323-3p	CLIP-seq
MIRT2040813	hsa-miR-329	CLIP-seq
MIRT2040814	hsa-miR-340	CLIP-seq
MIRT2040815	hsa-miR-34a	CLIP-seq
MIRT2040816	hsa-miR-3529	CLIP-seq
MIRT1143408	hsa-miR-3613-3p	CLIP-seq
MIRT1143409	hsa-miR-361-5p	CLIP-seq
MIRT2040817	hsa-miR-362-3p	CLIP-seq
MIRT1143468	hsa-miR-3662	CLIP-seq
MIRT2040818	hsa-miR-3674	CLIP-seq
MIRT2040819	hsa-miR-3679-3p	CLIP-seq
MIRT1143411	hsa-miR-3689a-3p	CLIP-seq
MIRT1143412	hsa-miR-3689c	CLIP-seq
MIRT1143413	hsa-miR-3689d	CLIP-seq
MIRT2040820	hsa-miR-3692	CLIP-seq
MIRT1143415	hsa-miR-371-5p	CLIP-seq
MIRT1143416	hsa-miR-371b-5p	CLIP-seq
MIRT2040821	hsa-miR-379	CLIP-seq
MIRT1143419	hsa-miR-381	CLIP-seq
MIRT2040822	hsa-miR-383	CLIP-seq
MIRT1143420	hsa-miR-3913-5p	CLIP-seq
MIRT1143422	hsa-miR-3929	CLIP-seq
MIRT2040823	hsa-miR-425	CLIP-seq
MIRT2040824	hsa-miR-4255	CLIP-seq
MIRT2040825	hsa-miR-4262	CLIP-seq
MIRT2040826	hsa-miR-4273	CLIP-seq
MIRT1143423	hsa-miR-4277	CLIP-seq
MIRT1143424	hsa-miR-4282	CLIP-seq
MIRT2040827	hsa-miR-4284	CLIP-seq
MIRT2040828	hsa-miR-4307	CLIP-seq
MIRT1143426	hsa-miR-4419b	CLIP-seq
MIRT2040829	hsa-miR-4451	CLIP-seq
MIRT2040830	hsa-miR-4453	CLIP-seq
MIRT1143471	hsa-miR-4474-3p	CLIP-seq
MIRT1143429	hsa-miR-4478	CLIP-seq
MIRT1143430	hsa-miR-4483	CLIP-seq
MIRT1143431	hsa-miR-4490	CLIP-seq
MIRT2040831	hsa-miR-449b	CLIP-seq
MIRT2040832	hsa-miR-449c	CLIP-seq
MIRT2040833	hsa-miR-4504	CLIP-seq
MIRT2040834	hsa-miR-4521	CLIP-seq
MIRT2040835	hsa-miR-4538	CLIP-seq
MIRT2040836	hsa-miR-4540	CLIP-seq
MIRT2040837	hsa-miR-4650-3p	CLIP-seq
MIRT1143433	hsa-miR-4666-3p	CLIP-seq
MIRT2040838	hsa-miR-4666-5p	CLIP-seq
MIRT1143435	hsa-miR-4684-5p	CLIP-seq
MIRT2040839	hsa-miR-4687-5p	CLIP-seq
MIRT1143436	hsa-miR-4711-3p	CLIP-seq
MIRT2040840	hsa-miR-4711-5p	CLIP-seq
MIRT2040841	hsa-miR-4725-5p	CLIP-seq
MIRT1143437	hsa-miR-4728-5p	CLIP-seq
MIRT2040842	hsa-miR-4729	CLIP-seq
MIRT2040843	hsa-miR-4731-5p	CLIP-seq
MIRT1143439	hsa-miR-4774-5p	CLIP-seq
MIRT2040844	hsa-miR-4793-5p	CLIP-seq
MIRT1143443	hsa-miR-4803	CLIP-seq
MIRT1143444	hsa-miR-485-5p	CLIP-seq
MIRT1143445	hsa-miR-495	CLIP-seq
MIRT1143446	hsa-miR-500a	CLIP-seq
MIRT1143447	hsa-miR-502-5p	CLIP-seq
MIRT2040845	hsa-miR-504	CLIP-seq
MIRT2040846	hsa-miR-513c	CLIP-seq
MIRT2040847	hsa-miR-514b-5p	CLIP-seq
MIRT2040848	hsa-miR-548aa	CLIP-seq
MIRT2040849	hsa-miR-550b	CLIP-seq
MIRT2040850	hsa-miR-579	CLIP-seq
MIRT1143448	hsa-miR-581	CLIP-seq
MIRT1143449	hsa-miR-592	CLIP-seq
MIRT2040851	hsa-miR-595	CLIP-seq
MIRT1143451	hsa-miR-599	CLIP-seq
MIRT2040852	hsa-miR-610	CLIP-seq
MIRT2040853	hsa-miR-629	CLIP-seq
MIRT2040854	hsa-miR-642b	CLIP-seq
MIRT1143454	hsa-miR-661	CLIP-seq
MIRT2040855	hsa-miR-664	CLIP-seq
MIRT1143455	hsa-miR-759	CLIP-seq
MIRT2040796	hsa-miR-1205	CLIP-seq
MIRT2040797	hsa-miR-1206	CLIP-seq
MIRT1143384	hsa-miR-1207-3p	CLIP-seq
MIRT2040798	hsa-miR-1228	CLIP-seq
MIRT2270485	hsa-miR-1269	CLIP-seq
MIRT2270486	hsa-miR-1269b	CLIP-seq
MIRT1143386	hsa-miR-1271	CLIP-seq
MIRT1143388	hsa-miR-1284	CLIP-seq
MIRT1143458	hsa-miR-1290	CLIP-seq
MIRT1143389	hsa-miR-1293	CLIP-seq
MIRT2270487	hsa-miR-1297	CLIP-seq
MIRT2270488	hsa-miR-1305	CLIP-seq
MIRT1143390	hsa-miR-130a	CLIP-seq
MIRT1143391	hsa-miR-130b	CLIP-seq
MIRT1143392	hsa-miR-182	CLIP-seq
MIRT1143393	hsa-miR-186	CLIP-seq
MIRT2270489	hsa-miR-1912	CLIP-seq
MIRT2040805	hsa-miR-2114	CLIP-seq
MIRT2040806	hsa-miR-2117	CLIP-seq
MIRT2040807	hsa-miR-23a	CLIP-seq
MIRT2040808	hsa-miR-23b	CLIP-seq
MIRT2040809	hsa-miR-23c	CLIP-seq
MIRT2040810	hsa-miR-24	CLIP-seq
MIRT2040811	hsa-miR-2682	CLIP-seq
MIRT2270490	hsa-miR-26a	CLIP-seq
MIRT2270491	hsa-miR-26b	CLIP-seq
MIRT1143395	hsa-miR-300	CLIP-seq
MIRT1143396	hsa-miR-301a	CLIP-seq
MIRT1143397	hsa-miR-301b	CLIP-seq
MIRT1143399	hsa-miR-31	CLIP-seq
MIRT1143400	hsa-miR-3122	CLIP-seq
MIRT1143402	hsa-miR-3143	CLIP-seq
MIRT1143465	hsa-miR-3165	CLIP-seq
MIRT1143466	hsa-miR-3167	CLIP-seq
MIRT1143467	hsa-miR-323-3p	CLIP-seq
MIRT1143406	hsa-miR-335	CLIP-seq
MIRT1143407	hsa-miR-337-3p	CLIP-seq
MIRT2040814	hsa-miR-340	CLIP-seq
MIRT2040815	hsa-miR-34a	CLIP-seq
MIRT1143409	hsa-miR-361-5p	CLIP-seq
MIRT2270492	hsa-miR-3665	CLIP-seq
MIRT1143410	hsa-miR-3666	CLIP-seq
MIRT1143411	hsa-miR-3689a-3p	CLIP-seq
MIRT1143412	hsa-miR-3689c	CLIP-seq
MIRT1143414	hsa-miR-369-3p	CLIP-seq
MIRT1143417	hsa-miR-374a	CLIP-seq
MIRT1143418	hsa-miR-374b	CLIP-seq
MIRT1143419	hsa-miR-381	CLIP-seq
MIRT2040822	hsa-miR-383	CLIP-seq
MIRT1143420	hsa-miR-3913-5p	CLIP-seq
MIRT1143422	hsa-miR-3929	CLIP-seq
MIRT2040824	hsa-miR-4255	CLIP-seq
MIRT2040826	hsa-miR-4273	CLIP-seq
MIRT1143423	hsa-miR-4277	CLIP-seq
MIRT2040827	hsa-miR-4284	CLIP-seq
MIRT1143425	hsa-miR-4295	CLIP-seq
MIRT1143426	hsa-miR-4419b	CLIP-seq
MIRT2270493	hsa-miR-4465	CLIP-seq
MIRT1143429	hsa-miR-4478	CLIP-seq
MIRT1143430	hsa-miR-4483	CLIP-seq
MIRT2040831	hsa-miR-449b	CLIP-seq
MIRT2040832	hsa-miR-449c	CLIP-seq
MIRT2270494	hsa-miR-4520b-3p	CLIP-seq
MIRT2270495	hsa-miR-4529-3p	CLIP-seq
MIRT1143432	hsa-miR-454	CLIP-seq
MIRT1143434	hsa-miR-4671-3p	CLIP-seq
MIRT2040839	hsa-miR-4687-5p	CLIP-seq
MIRT1143437	hsa-miR-4728-5p	CLIP-seq
MIRT2040842	hsa-miR-4729	CLIP-seq
MIRT1143440	hsa-miR-4793-3p	CLIP-seq
MIRT2040844	hsa-miR-4793-5p	CLIP-seq
MIRT1143443	hsa-miR-4803	CLIP-seq
MIRT1143444	hsa-miR-485-5p	CLIP-seq
MIRT1143446	hsa-miR-500a	CLIP-seq
MIRT2040846	hsa-miR-513c	CLIP-seq
MIRT2040847	hsa-miR-514b-5p	CLIP-seq
MIRT2040848	hsa-miR-548aa	CLIP-seq
MIRT2040850	hsa-miR-579	CLIP-seq
MIRT2270496	hsa-miR-591	CLIP-seq
MIRT1143453	hsa-miR-633	CLIP-seq
MIRT2270497	hsa-miR-657	CLIP-seq
MIRT1143484	hsa-miR-876-5p	CLIP-seq
MIRT2270498	hsa-miR-940	CLIP-seq
MIRT1143456	hsa-miR-96	CLIP-seq
MIRT1143395	hsa-miR-300	CLIP-seq
MIRT1143419	hsa-miR-381	CLIP-seq
MIRT1143433	hsa-miR-4666-3p	CLIP-seq
MIRT2040846	hsa-miR-513c	CLIP-seq
MIRT2040847	hsa-miR-514b-5p	CLIP-seq
MIRT2040854	hsa-miR-642b	CLIP-seq
MIRT1143387	hsa-miR-1283	CLIP-seq
MIRT1143389	hsa-miR-1293	CLIP-seq
MIRT1143400	hsa-miR-3122	CLIP-seq
MIRT1143465	hsa-miR-3165	CLIP-seq
MIRT1143408	hsa-miR-3613-3p	CLIP-seq
MIRT1143411	hsa-miR-3689a-3p	CLIP-seq
MIRT1143412	hsa-miR-3689c	CLIP-seq
MIRT1143415	hsa-miR-371-5p	CLIP-seq
MIRT1143416	hsa-miR-371b-5p	CLIP-seq
MIRT1143420	hsa-miR-3913-5p	CLIP-seq
MIRT1143422	hsa-miR-3929	CLIP-seq
MIRT1143426	hsa-miR-4419b	CLIP-seq
MIRT1143427	hsa-miR-4421	CLIP-seq
MIRT1143429	hsa-miR-4478	CLIP-seq
MIRT1143430	hsa-miR-4483	CLIP-seq
MIRT1143435	hsa-miR-4684-5p	CLIP-seq
MIRT1143437	hsa-miR-4728-5p	CLIP-seq
MIRT1143444	hsa-miR-485-5p	CLIP-seq
MIRT1143445	hsa-miR-495	CLIP-seq
MIRT1143446	hsa-miR-500a	CLIP-seq
MIRT1143383	hsa-miR-1	CLIP-seq
MIRT2569626	hsa-miR-101	CLIP-seq
MIRT2569627	hsa-miR-1266	CLIP-seq
MIRT1143457	hsa-miR-128	CLIP-seq
MIRT1143387	hsa-miR-1283	CLIP-seq
MIRT1143388	hsa-miR-1284	CLIP-seq
MIRT1143389	hsa-miR-1293	CLIP-seq
MIRT2270487	hsa-miR-1297	CLIP-seq
MIRT2569628	hsa-miR-144	CLIP-seq
MIRT1143459	hsa-miR-148a	CLIP-seq
MIRT1143460	hsa-miR-148b	CLIP-seq
MIRT1143461	hsa-miR-152	CLIP-seq
MIRT1143392	hsa-miR-182	CLIP-seq
MIRT2040804	hsa-miR-2052	CLIP-seq
MIRT1143462	hsa-miR-2113	CLIP-seq
MIRT2270490	hsa-miR-26a	CLIP-seq
MIRT2270491	hsa-miR-26b	CLIP-seq
MIRT1143463	hsa-miR-27a	CLIP-seq
MIRT1143464	hsa-miR-27b	CLIP-seq
MIRT1143395	hsa-miR-300	CLIP-seq
MIRT1143400	hsa-miR-3122	CLIP-seq
MIRT2569629	hsa-miR-3124-3p	CLIP-seq
MIRT2569630	hsa-miR-3136-5p	CLIP-seq
MIRT1143465	hsa-miR-3165	CLIP-seq
MIRT2569631	hsa-miR-3171	CLIP-seq
MIRT2040813	hsa-miR-329	CLIP-seq
MIRT2569632	hsa-miR-342-5p	CLIP-seq
MIRT1143408	hsa-miR-3613-3p	CLIP-seq
MIRT2040817	hsa-miR-362-3p	CLIP-seq
MIRT2569633	hsa-miR-3646	CLIP-seq
MIRT1143468	hsa-miR-3662	CLIP-seq
MIRT2040818	hsa-miR-3674	CLIP-seq
MIRT2569634	hsa-miR-3677-5p	CLIP-seq
MIRT2569635	hsa-miR-3682-3p	CLIP-seq
MIRT1143411	hsa-miR-3689a-3p	CLIP-seq
MIRT1143412	hsa-miR-3689c	CLIP-seq
MIRT2040820	hsa-miR-3692	CLIP-seq
MIRT1143415	hsa-miR-371-5p	CLIP-seq
MIRT1143416	hsa-miR-371b-5p	CLIP-seq
MIRT2569636	hsa-miR-380	CLIP-seq
MIRT1143419	hsa-miR-381	CLIP-seq
MIRT1143420	hsa-miR-3913-5p	CLIP-seq
MIRT1143422	hsa-miR-3929	CLIP-seq
MIRT1143469	hsa-miR-4263	CLIP-seq
MIRT1143423	hsa-miR-4277	CLIP-seq
MIRT1143424	hsa-miR-4282	CLIP-seq
MIRT2569637	hsa-miR-4283	CLIP-seq
MIRT2569638	hsa-miR-4314	CLIP-seq
MIRT1143426	hsa-miR-4419b	CLIP-seq
MIRT1143427	hsa-miR-4421	CLIP-seq
MIRT2569639	hsa-miR-4439	CLIP-seq
MIRT2040830	hsa-miR-4453	CLIP-seq
MIRT2270493	hsa-miR-4465	CLIP-seq
MIRT1143428	hsa-miR-4470	CLIP-seq
MIRT1143471	hsa-miR-4474-3p	CLIP-seq
MIRT1143429	hsa-miR-4478	CLIP-seq
MIRT2569640	hsa-miR-4481	CLIP-seq
MIRT1143430	hsa-miR-4483	CLIP-seq
MIRT2569641	hsa-miR-4489	CLIP-seq
MIRT2569642	hsa-miR-4502	CLIP-seq
MIRT2569643	hsa-miR-4518	CLIP-seq
MIRT2569644	hsa-miR-451b	CLIP-seq
MIRT2040835	hsa-miR-4538	CLIP-seq
MIRT2569645	hsa-miR-4651	CLIP-seq
MIRT2569646	hsa-miR-4664-5p	CLIP-seq
MIRT1143433	hsa-miR-4666-3p	CLIP-seq
MIRT2569647	hsa-miR-4667-5p	CLIP-seq
MIRT1143435	hsa-miR-4684-5p	CLIP-seq
MIRT2569648	hsa-miR-4700-5p	CLIP-seq
MIRT2569649	hsa-miR-4704-5p	CLIP-seq
MIRT2569650	hsa-miR-4719	CLIP-seq
MIRT1143437	hsa-miR-4728-5p	CLIP-seq
MIRT2040843	hsa-miR-4731-5p	CLIP-seq
MIRT2569651	hsa-miR-4738-3p	CLIP-seq
MIRT2569652	hsa-miR-4742-3p	CLIP-seq
MIRT2569653	hsa-miR-4745-5p	CLIP-seq
MIRT2569654	hsa-miR-4758-5p	CLIP-seq
MIRT2569655	hsa-miR-4774-3p	CLIP-seq
MIRT1143441	hsa-miR-4796-5p	CLIP-seq
MIRT1143442	hsa-miR-4797-5p	CLIP-seq
MIRT1143477	hsa-miR-4799-5p	CLIP-seq
MIRT1143444	hsa-miR-485-5p	CLIP-seq
MIRT2569656	hsa-miR-494	CLIP-seq
MIRT1143445	hsa-miR-495	CLIP-seq
MIRT1143446	hsa-miR-500a	CLIP-seq
MIRT1143478	hsa-miR-513a-5p	CLIP-seq
MIRT2569657	hsa-miR-548t	CLIP-seq
MIRT1143480	hsa-miR-576-5p	CLIP-seq
MIRT2270496	hsa-miR-591	CLIP-seq
MIRT2569658	hsa-miR-608	CLIP-seq
MIRT1143452	hsa-miR-613	CLIP-seq
MIRT2569659	hsa-miR-637	CLIP-seq
MIRT2040854	hsa-miR-642b	CLIP-seq
MIRT2569660	hsa-miR-663b	CLIP-seq
MIRT1143455	hsa-miR-759	CLIP-seq
MIRT2569661	hsa-miR-767-3p	CLIP-seq
MIRT2569662	hsa-miR-943	CLIP-seq
MIRT2569663	hsa-miR-3650	CLIP-seq
MIRT2040820	hsa-miR-3692	CLIP-seq
MIRT2569664	hsa-miR-933	CLIP-seq
MIRT1143387	hsa-miR-1283	CLIP-seq
MIRT1143389	hsa-miR-1293	CLIP-seq
MIRT2270487	hsa-miR-1297	CLIP-seq
MIRT1143392	hsa-miR-182	CLIP-seq
MIRT2270490	hsa-miR-26a	CLIP-seq
MIRT2270491	hsa-miR-26b	CLIP-seq
MIRT1143400	hsa-miR-3122	CLIP-seq
MIRT1143465	hsa-miR-3165	CLIP-seq
MIRT2569631	hsa-miR-3171	CLIP-seq
MIRT2040813	hsa-miR-329	CLIP-seq
MIRT1143408	hsa-miR-3613-3p	CLIP-seq
MIRT2040817	hsa-miR-362-3p	CLIP-seq
MIRT2040818	hsa-miR-3674	CLIP-seq
MIRT2569635	hsa-miR-3682-3p	CLIP-seq
MIRT1143411	hsa-miR-3689a-3p	CLIP-seq
MIRT1143412	hsa-miR-3689c	CLIP-seq
MIRT1143415	hsa-miR-371-5p	CLIP-seq
MIRT1143416	hsa-miR-371b-5p	CLIP-seq
MIRT2569636	hsa-miR-380	CLIP-seq
MIRT1143420	hsa-miR-3913-5p	CLIP-seq
MIRT1143422	hsa-miR-3929	CLIP-seq
MIRT1143426	hsa-miR-4419b	CLIP-seq
MIRT1143427	hsa-miR-4421	CLIP-seq
MIRT2040830	hsa-miR-4453	CLIP-seq
MIRT2270493	hsa-miR-4465	CLIP-seq
MIRT1143428	hsa-miR-4470	CLIP-seq
MIRT1143429	hsa-miR-4478	CLIP-seq
MIRT1143430	hsa-miR-4483	CLIP-seq
MIRT2569642	hsa-miR-4502	CLIP-seq
MIRT2040835	hsa-miR-4538	CLIP-seq
MIRT1143435	hsa-miR-4684-5p	CLIP-seq
MIRT1143437	hsa-miR-4728-5p	CLIP-seq
MIRT2040843	hsa-miR-4731-5p	CLIP-seq
MIRT1143442	hsa-miR-4797-5p	CLIP-seq
MIRT1143444	hsa-miR-485-5p	CLIP-seq
MIRT1143445	hsa-miR-495	CLIP-seq
MIRT1143446	hsa-miR-500a	CLIP-seq
MIRT2040854	hsa-miR-642b	CLIP-seq
MIRT1143455	hsa-miR-759	CLIP-seq

Show/Hide all (12)

Transcription factor	Regulation	Reference
FOXP2	Repression	21832174
HIF1A	Activation	16099863
MITF	Unknown	17371876
PAX3	Unknown	8633043
PAX5	Activation	24628993
PAX5	Unknown	19139719
PAX6	Activation	19651775
SMAD7	Activation	15339794
SP1	Activation	11910354;21831840
SP1	Repression	21831840
TP53	Repression	21831840
YBX1	Activation	19648825

Show/Hide all (54)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001886	Process	Endothelial cell morphogenesis	IDA	14500721
GO:0001889	Process	Liver development	IBA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	NAS	3325883
GO:0004713	Function	Protein tyrosine kinase activity	TAS
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IEA
GO:0005008	Function	Hepatocyte growth factor receptor activity	IBA
GO:0005008	Function	Hepatocyte growth factor receptor activity	TAS	10871856
GO:0005515	Function	Protein binding	IPI	1846706, 11571281, 11590178, 12475979, 15167892, 15184888, 16101282, 16537444, 16537482, 17662939, 17804794, 17981115, 18273061, 18579758, 19167335, 19604117, 20624308, 20624990, 20802513, 21163258, 21242965, 22404908, 22789536, 22897854, 22962849, 23866081, 24034250, 24189400, 2472
GO:0005524	Function	ATP binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	TAS	1846706
GO:0007165	Process	Signal transduction	TAS	1846706
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	NAS	2819873
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IBA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IEA
GO:0009925	Component	Basal plasma membrane	IBA
GO:0009925	Component	Basal plasma membrane	IDA	15314156
GO:0009986	Component	Cell surface	HDA	19581412
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010507	Process	Negative regulation of autophagy	NAS	24743740
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	2819873
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0017154	Function	Semaphorin receptor activity	IEA
GO:0019903	Function	Protein phosphatase binding	IPI	18819921
GO:0030182	Process	Neuron differentiation	IBA
GO:0031016	Process	Pancreas development	IBA
GO:0031116	Process	Positive regulation of microtubule polymerization	IMP	25198505
GO:0035024	Process	Negative regulation of Rho protein signal transduction	IDA	25198505
GO:0042802	Function	Identical protein binding	IPI	16537482, 20624990
GO:0043235	Component	Receptor complex	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	22521434
GO:0048012	Process	Hepatocyte growth factor receptor signaling pathway	IEA
GO:0048468	Process	Cell development	IEA
GO:0048513	Process	Animal organ development	IEA
GO:0048754	Process	Branching morphogenesis of an epithelial tube	IMP	16153003
GO:0050918	Process	Positive chemotaxis	IDA	15218527
GO:0051497	Process	Negative regulation of stress fiber assembly	IDA	25198505
GO:0060079	Process	Excitatory postsynaptic potential	ISS
GO:0061436	Process	Establishment of skin barrier	IMP	25198505
GO:0070495	Process	Negative regulation of thrombin-activated receptor signaling pathway	IDA	25198505
GO:0071526	Process	Semaphorin-plexin signaling pathway	IDA	15218527
GO:0071526	Process	Semaphorin-plexin signaling pathway	IEA
GO:0098794	Component	Postsynapse	IEA
GO:0140677	Function	Molecular function activator activity	EXP	21247903
GO:1901299	Process	Negative regulation of hydrogen peroxide-mediated programmed cell death	IMP	20655899
GO:1905098	Process	Negative regulation of guanyl-nucleotide exchange factor activity	IDA	25198505
GO:2001028	Process	Positive regulation of endothelial cell chemotaxis	IMP	19850054

MIM	HGNC	e!Ensembl
164860	7029	ENSG00000105976

P08581

Protein name

Hepatocyte growth factor receptor (HGF receptor) (EC 2.7.10.1) (HGF/SF receptor) (Proto-oncogene c-Met) (Scatter factor receptor) (SF receptor) (Tyrosine-protein kinase Met)

Protein function

Receptor tyrosine kinase that transduces signals from the extracellular matrix into the cytoplasm by binding to hepatocyte growth factor/HGF ligand. Regulates many physiological processes including proliferation, scattering, morphogenesis and su

PDB

1FYR , 1R0P , 1R1W , 1SHY , 1SSL , 2G15 , 2RFN , 2RFS , 2UZX , 2UZY , 2WD1 , 2WGJ , 2WKM , 3A4P , 3BUX , 3C1X , 3CCN , 3CD8 , 3CE3 , 3CTH , 3CTJ , 3DKC , 3DKF , 3DKG , 3EFJ , 3EFK , 3F66 , 3F82 , 3I5N , 3L8V , 3LQ8 , 3Q6U , 3Q6W , 3QTI , 3R7O , 3RHK , 3U6H , 3U6I , 3VW8 , 3ZBX , 3ZC5 , 3ZCL , 3ZXZ , 3ZZE , 4AOI , 4AP7 , 4DEG , 4DEH , 4DEI , 4EEV , 4GG5

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01403	Sema	54 → 493	Sema domain	Family
PF01437	PSI	519 → 562	Plexin repeat	Family
PF01833	TIG	563 → 654	IPT/TIG domain	Domain
PF01833	TIG	657 → 738	IPT/TIG domain	Domain
PF01833	TIG	742 → 832	IPT/TIG domain	Domain
PF07714	PK_Tyr_Ser-Thr	1078 → 1337	Protein tyrosine and serine/threonine kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in normal hepatocytes as well as in epithelial cells lining the stomach, the small and the large intestine. Found also in basal keratinocytes of esophagus and skin. High levels are found in liver, gastrointestinal tract, thyr

Sequence

MKAPAVLAPGILVLLFTLVQRSNGECKEALAKSEMNVNMKYQLPNFTAETPIQNVILHEH
HIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMAL
VVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSAL
GAKVLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRLKETKDGFMFLTDQSYIDVLPE
FRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRIIRFCSINSGLHSYMEMPLECIL
TEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSKPDSAEPMDRS
AMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARRDEYRTEF
TTALQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFL
LDSHPVSPEVIVEHTLNQNGYTLVITGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGW
CHDKCVRSEECLSGTWTQQICLPAIYKVFPNSAPLEGGTRLTICGWDFGFRRNNKFDLKK
TRVLLGNESCTLTLSESTMNTLKCTVGPAMNKHFNMSIIISNGHGTTQYSTFSYVDPVIT
SISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGKTCTLKSVSNSILECYTPAQTISTEF
AVKLKIDLANRETSIFSYREDPIVYEIHPTKSFISGGSTITGVGKNLNSVSVPRMVINVH
EAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGILSKYFDLIYVHNPV
FKPFEKPVMISMGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIHLHSEAVLCTVPNDL
LKLNSELNIEWKQAISSTVLGKVIVQPDQNFTGLIAGVVSISTALLLLLGFFLWLKKRKQ
IKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGS
CRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHF
NEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVL
SLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKF
VHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKF
TTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCW
HPKAEMRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSEDNADDEVD
TRPASFWETS

Sequence length

1390

Interactions

View interactions

	KEGG		Reactome
	EGFR tyrosine kinase inhibitor resistance MAPK signaling pathway Ras signaling pathway Rap1 signaling pathway Calcium signaling pathway PI3K-Akt signaling pathway Axon guidance Focal adhesion Adherens junction Bacterial invasion of epithelial cells Epithelial cell signaling in Helicobacter pylori infection Malaria Pathways in cancer Transcriptional misregulation in cancer Proteoglycans in cancer MicroRNAs in cancer Chemical carcinogenesis - reactive oxygen species Renal cell carcinoma Melanoma Non-small cell lung cancer Hepatocellular carcinoma Gastric cancer Central carbon metabolism in cancer		PIP3 activates AKT signaling Constitutive Signaling by Aberrant PI3K in Cancer Sema4D mediated inhibition of cell attachment and migration RAF/MAP kinase cascade MET Receptor Activation Negative regulation of MET activity PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling MET activates RAS signaling MET activates PI3K/AKT signaling MET activates PTPN11 MET activates PTK2 signaling InlB-mediated entry of Listeria monocytogenes into host cell MET interacts with TNS proteins MET activates RAP1 and RAC1 MET receptor recycling MET activates STAT3 MECP2 regulates neuronal receptors and channels

7793

Show/Hide Causal Diseases (14)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Arthrogryposis, distal, IIa 11	Likely pathogenic; Pathogenic	rs121913243, rs1554400286	RCV005394153 RCV002279723
Arthrogryposis, distal, type 1A	Pathogenic	rs1554400286	RCV000626485
Autosomal recessive nonsyndromic hearing loss 97	Pathogenic; Likely pathogenic	rs794728016, rs121913243	RCV000202585 RCV005394153
Colorectal cancer	Pathogenic	rs1794836064	RCV001293831
Embryonal rhabdomyosarcoma	Pathogenic; Likely pathogenic	rs121913671, rs121913245	RCV006253587 RCV006253979
Hepatocellular carcinoma	Likely pathogenic; Pathogenic	rs121913243	RCV005394153
Hereditary cancer-predisposing syndrome	Likely pathogenic; Pathogenic	rs786202724, rs121913668, rs121913670, rs121913243, rs121913245	RCV000165679 RCV000565834 RCV000221989 RCV002321481 RCV003168614
Hereditary papillary renal cell carcinoma	Likely pathogenic; Pathogenic	rs121913668	RCV005600617
MET-related disorder	Likely pathogenic; Pathogenic	rs121913243	RCV003407332
Nonsyndromic Hearing Loss and Deafness, Autosomal Recessive	Pathogenic	rs794728016	RCV000185580
Osteofibrous dysplasia	Likely pathogenic; Pathogenic	rs121913243	RCV005394153
Papillary renal cell carcinoma type 1	Likely pathogenic; Pathogenic	rs786202724, rs121913668, rs121913669, rs121913670, rs121913671, rs121913243	RCV000709041 RCV000014895 RCV000014896 RCV000014897 RCV000014898 RCV000014901
Pediatric hepatocellular carcinoma	Pathogenic	rs121913676, rs121913677	RCV000014903 RCV000014904
Renal cell carcinoma	Likely pathogenic; Pathogenic	rs786202724, rs121913668, rs121913670, rs121913243	RCV001376633 RCV002228027 RCV001376555 RCV001376564

Show/Hide Unknown Diseases (29)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Autism, susceptibility to, 9	Uncertain significance	rs1858830	RCV000014905
Breast carcinoma	Conflicting classifications of pathogenicity	rs45602940, rs199701987	RCV005429001 RCV001262296
Cervical cancer	Benign; Likely benign	rs1584947055	RCV005907054
Cholangiocarcinoma	Benign; Likely benign	rs146651797, rs12540703	RCV005889558 RCV005899173
Classic Hodgkin lymphoma	Conflicting classifications of pathogenicity	rs56391007	RCV002227927
Clear cell carcinoma of kidney	Benign; Likely benign	rs146651797	RCV005889557
Colon adenocarcinoma	Benign; Likely benign; Uncertain significance	rs45572835, rs2116925510, rs11762213	RCV005893575 RCV005939440 RCV005886266
Congenital diaphragmatic hernia	Conflicting classifications of pathogenicity	rs56391007	RCV000203290
Diffuse pediatric-type high-grade glioma, H3-wildtype and IDH-wildtype	Uncertain significance	rs1794851612	RCV006254256
Familial cancer of breast	Benign; Likely benign	rs45572835	RCV005893574
Gastric cancer	Benign; Likely benign	rs57349036, rs186524917, rs766900241	RCV005867187 RCV005869846 RCV005899169 RCV005869638
Hepatoblastoma	Conflicting classifications of pathogenicity	rs199771406	RCV001843487
Hereditary cancer	Conflicting classifications of pathogenicity; Uncertain significance; Benign; Likely benign	rs200074800, rs375353223, rs370529693, rs56311081, rs199701987, rs375576430, rs1793418567, rs763344951, rs863224695, rs1351264833, rs771333219, rs764246939, rs201315884, rs779897466, rs761951444, rs1584941903, rs201274041 View all (2 more)	RCV003492511 RCV003492526 RCV003492548 RCV003492549 RCV005235038 RCV005235073 RCV003492762 RCV004700517 RCV003491946 RCV003492845 RCV003492062 RCV003492061 RCV003492328 RCV003492138 RCV003492139 RCV004702488 RCV004700392
Intellectual disability	Conflicting classifications of pathogenicity	rs35776110, rs200861145, rs45564937, rs370499060	RCV001252073 RCV001252075 RCV001252072 RCV001252074
Lung cancer	-	rs869320707, rs1794851763	RCV005909228 RCV005909227
Lung carcinoma	Uncertain significance	rs1794851612	RCV001263105
Lymphedema	Conflicting classifications of pathogenicity; Uncertain significance	rs180985111, rs367722737, rs1793380587	RCV000148614 RCV004565317 RCV005863334
Malignant tumor of esophagus	Benign; Uncertain significance	rs12540703, rs1584955273, rs11762213	RCV005899170 RCV005912161 RCV005886268
Neuroblastoma	other	rs1554378983	RCV000505625
Nonpapillary renal cell carcinoma	Benign; Likely benign	rs57349036, rs11762213	RCV005867184 RCV005886269
Nonsyndromic genetic hearing loss	Conflicting classifications of pathogenicity	rs35189619, rs587780736	RCV005361975 RCV005361068
Ovarian cancer	Conflicting classifications of pathogenicity	rs45592846, rs746295363, rs752694306, rs45586239, rs376459715, rs1319458719, rs1398243931	RCV003154019 RCV003154195 RCV003154046 RCV003153543 RCV003153672 RCV003153888 RCV003153915
Ovarian serous cystadenocarcinoma	Uncertain significance	rs41736, rs2116834434	RCV005931373 RCV005939439
Sarcoma	Benign	rs12540703	RCV005899171
Squamous cell lung carcinoma	Conflicting classifications of pathogenicity; Uncertain significance	rs45602940, rs1794304820	RCV005429001 RCV001250972
Thymoma	Benign; Likely benign	rs57349036, rs12540703, rs11762213	RCV005867188 RCV005899172 RCV005886272
Thyroid cancer, nonmedullary, 1	Uncertain significance	rs2116993301	RCV005939441
Uterine corpus endometrial carcinoma	Conflicting classifications of pathogenicity; Benign	rs372830789, rs12540703, rs11762213	RCV005893595 RCV005899174 RCV005886273
Uveal melanoma	Benign; Likely benign	rs57349036, rs11762213	RCV005867185 RCV005869845 RCV005886270

Show/Hide Text Mining Associations (208)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Abnormalities Drug Induced	Associate	30149144
Adenocarcinoma	Associate	15720819, 22198430, 28859123, 8097369, 8440743, 8957065, 9876767
Adenocarcinoma Mucinous	Associate	30638462
Adenocarcinoma of Lung	Associate	11290563, 17459054, 23919423, 25278243, 25902175, 27496196, 29400000, 30615629, 31711449, 32395869, 36544145, 36640859
Adenoma	Stimulate	10944610
Adenoma	Associate	20200025
Adenoma Liver Cell	Associate	29256857
Adenoma Pleomorphic	Associate	21626008
Androgen Insensitivity Syndrome	Associate	28859123
Apraxia Ideomotor	Associate	22180430
Astrocytoma	Associate	10063359
Autism Spectrum Disorder	Associate	19360663, 23097380, 24150225, 24240654
Autistic Disorder	Associate	19002214, 19548256, 22110649, 22833194
Barrett Esophagus	Associate	32373217
Biliary Tract Neoplasms	Associate	27136744
Bone Diseases	Associate	25990623
Brain Neoplasms	Associate	19773441, 20200025, 29923182
Brain Neoplasms	Stimulate	31811234
Breast Neoplasms	Associate	12793903, 17244359, 20042668, 20460509, 21692045, 22374333, 22945653, 24150964, 25065564, 25492484, 27055285, 30004628, 30314527, 30444219, 30962283 View all (6 more)
Breast Neoplasms	Stimulate	26968553
Breast Neoplasms Male	Associate	32188473
Calcinosis Cutis	Associate	34708249
Carcinogenesis	Associate	11073815, 15154624, 15839837, 16609989, 16804974, 22640970, 25220207, 27136744, 31744884, 35645542, 8440743, 9876767
Carcinoma	Associate	10702398, 18059365
Carcinoma Adenoid Cystic	Associate	25923130
Carcinoma Basal Cell	Associate	29920512
Carcinoma Ductal Breast	Associate	17244359
Carcinoma Hepatocellular	Associate	11854908, 19490101, 20501828, 21572247, 21658389, 21737452, 22418436, 22912725, 22962849, 23006961, 23552472, 24516705, 25148256, 25591763, 25620570 View all (16 more)
Carcinoma Hepatocellular	Stimulate	29256857
Carcinoma Intraductal Noninfiltrating	Associate	17244359, 26496879, 33414541
Carcinoma Non Small Cell Lung	Associate	15083185, 17459054, 18467317, 19096301, 19381876, 19648825, 20647329, 21423210, 21779788, 22198430, 22466960, 22617250, 23527257, 23734217, 24223799 View all (43 more)
Carcinoma Non Small Cell Lung	Stimulate	27546183
Carcinoma Ovarian Epithelial	Associate	10433927, 16014115, 35144591, 38250760
Carcinoma Pancreatic Ductal	Associate	28064436, 28445954, 31284422
Carcinoma Renal Cell	Associate	10433944, 22198430, 23022995, 23219378, 23791828, 23895657, 24609899, 26505625, 26951228, 27894094, 28358873, 30149144, 31575031, 31994979, 32392161 View all (4 more)
Carcinoma Squamous Cell	Associate	21849853, 22768234, 33990404, 34171074, 8097369, 8957065
Cell Transformation Neoplastic	Associate	10702398, 11238734
Cholangiocarcinoma	Associate	20565817, 21673683, 25536104, 25873560, 26018028, 30850583
Chondrosarcoma	Associate	12183053, 23320110
Chordoma	Associate	28272674, 34127734
Chronic Limb Threatening Ischemia	Associate	24947080
Colitis Ulcerative	Associate	26229399
Colonic Diseases	Associate	35645542
Colonic Neoplasms	Associate	20661223
Colonic Polyps	Associate	32198312
Colorectal Neoplasms	Associate	10944610, 11073815, 16237757, 18395971, 20661223, 21955323, 23194063, 23580180, 24205104, 24863535, 25090459, 25220207, 26459369, 26553611, 27793046 View all (15 more)
COVID 19	Associate	32758869
Deafness	Associate	25941349
Death	Associate	22374333, 23219378
Degloving Injuries	Associate	26988277
Diabetes Mellitus	Associate	19933191, 21866211, 25446319, 33181273
Diabetes Mellitus Type 1	Associate	31396209
Diabetic Nephropathies	Associate	30143691
Diffuse Intrinsic Pontine Glioma	Associate	25534822
Disease	Associate	26459369
Drug Related Side Effects and Adverse Reactions	Associate	26988277, 37041472
Dysplastic Nevus Syndrome	Associate	32198312
Endometrial Neoplasms	Associate	12524084, 22617129, 29630089, 31686413
Endometriosis	Associate	12524084
Epilepsy Partial with Variable Foci	Stimulate	37812383
Epiretinal Membrane	Associate	15156160
Epstein Barr Virus Infections	Associate	16609989
Epstein Barr Virus Infections	Stimulate	9028331
Esophageal Neoplasms	Associate	17062664, 22976495, 30569129, 35242498
Esophageal Squamous Cell Carcinoma	Associate	25588551, 26036285, 26810066, 35242498
Esthesioneuroblastoma Olfactory	Associate	29324814
Fetal Growth Retardation	Associate	9777945
Fibrosis	Associate	24516705, 30143691
Focal Epithelial Hyperplasia	Associate	8546209
Gastro enteropancreatic neuroendocrine tumor	Stimulate	37955612
Gastrointestinal Diseases	Associate	19548256
Gastrointestinal Stromal Tumors	Associate	25557174
Glioblastoma	Associate	11238734, 18973197, 22323597, 24518591, 25825051, 29238047, 30886866, 31502574, 31776899, 33727583, 7556648
Glioblastoma	Stimulate	31575848
Glioma	Associate	16082194, 18992144, 19773441, 20157762, 20190569, 20200025, 23619925, 26654598, 26823824, 26879272, 28965162, 33268783, 35100091, 7556648
Glucosephosphate Dehydrogenase Deficiency	Associate	31686413
Glycogen Storage Disease IIIC	Associate	16014115
Hashimoto Disease	Associate	15292926, 20558345
Head and Neck Neoplasms	Associate	23213056
Hearing Loss	Associate	25941349
Hepatoblastoma	Associate	21992464
Hereditary leiomyomatosis and renal cell cancer	Associate	11159538
Hodgkin Disease	Associate	11159538, 22180430, 9028331
Hypoxia	Associate	17406354, 22383739, 23696831, 23927384
Hypoxia	Stimulate	18422749, 26018028, 29855336
Hypoxia Brain	Stimulate	18422749
Idiopathic Pulmonary Fibrosis	Associate	37812383
Impotence Vasculogenic	Associate	26189059
Infections	Associate	34758302
Inflammation	Associate	21048961, 9373255
Inflammation	Stimulate	29256857
Inflammation	Inhibit	32822114
Inflammatory Bowel Diseases	Associate	35645542
Inflammatory Breast Neoplasms	Associate	27528224
Ischemia	Inhibit	26742633
Kidney Diseases	Associate	30143691
Kidney Failure Chronic	Stimulate	30143691
Kidney Neoplasms	Associate	36138026, 37898101
Leukemia	Associate	17673463, 24561793
Leukemia Biphenotypic Acute	Associate	17673463
Leukemia Lymphocytic Chronic B Cell	Associate	20809501, 21486864, 24561793
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	22904675
Leukemia Myeloid Acute	Associate	34789086
Leukemia T Cell	Associate	24223100
Liposarcoma	Associate	31126284
Liver Cirrhosis Biliary	Associate	16216128
Liver Failure	Associate	35236826
Liver Neoplasms	Associate	35236826
Lung Diseases	Associate	12177240, 39217894
Lung Diseases Interstitial	Associate	37812383
Lung Neoplasms	Associate	18395971, 21043826, 23087254, 23360489, 23801885, 24285539, 24627222, 24638075, 25834821, 25869878, 27343443, 27396618, 29615769, 30615629, 33574356 View all (6 more)
Lung Neoplasms	Stimulate	31104010
Lymphangitis	Associate	34516491
Lymphatic Metastasis	Associate	15154624, 16014115, 21779788, 23812675, 23927384, 25592281, 26968553, 28590585, 29360662, 30897285, 33655604, 35650563
Lymphatic Metastasis	Stimulate	22640970, 24393368
Lymphedema	Associate	18564920
Lymphoma	Associate	9028331
Lymphoma Large B Cell Diffuse	Associate	15491290
Lymphoma Large Cell Anaplastic	Associate	30477470
Lymphoma Non Hodgkin	Stimulate	27559738
Lymphoma Non Hodgkin	Associate	9028331
Lymphoma Primary Effusion	Associate	28407694
Lymphoma T Cell	Associate	19120365
Malignant mesenchymal tumor	Associate	33693450
Mediastinal Emphysema	Associate	16216128
Medulloblastoma	Associate	18059365, 18992144
Melanoma	Associate	19032678, 20164843, 21654344, 22020736, 27689874, 31877948, 33451139, 37377890, 8104462
Melanoma	Stimulate	29923182
Meningioma	Associate	20200025
Mesothelioma	Associate	17872495, 22065079, 31709947, 36683050
Mesothelioma Malignant	Associate	17872495, 27705913, 36683050
Metabolic Syndrome	Associate	34059694
Mouth Diseases	Associate	35645542
Multiple Myeloma	Associate	19187270, 30353654, 32198978, 8916966
Musculoskeletal Diseases	Associate	10702398, 8863670
Myocardial Infarction	Associate	10598900
Myoclonic Epilepsies Progressive	Associate	12145210
Myopia	Associate	19471602, 24766640
Myositis	Associate	12707036
Myotonic Disorders	Stimulate	18163995
Nasal Polyps	Associate	20819464
Nasopharyngeal Neoplasms	Associate	18789327, 21057531
Neoplasm Metastasis	Associate	10037743, 11290563, 11854908, 12464636, 16455654, 18395971, 19490101, 19502802, 20085644, 21575221, 21779788, 22976495, 23812675, 24977165, 25923130 View all (15 more)
Neoplasm Metastasis	Stimulate	27793046, 9028331
Neoplasms	Associate	10037743, 12183053, 12464636, 12719469, 15083185, 15274358, 16014115, 17459054, 17872495, 17948912, 18234969, 18395971, 18422749, 18815565, 18845790 View all (134 more)
Neoplasms	Stimulate	10433927, 10944610, 22640970, 26298849, 26334097, 30361909, 36672275, 37945598, 8097369
Neoplasms Cystic Mucinous and Serous	Associate	10433927
Neoplasms Germ Cell and Embryonal	Associate	30646583
Neoplasms Radiation Induced	Associate	39265740
Neoplastic Syndromes Hereditary	Associate	31575031
Neurilemmoma	Associate	20200025
Neuroblastoma	Associate	19939254
Neuroma Acoustic	Associate	25692621
Optic Nerve Glioma	Associate	18234969
Oral Submucous Fibrosis	Associate	27497264
Osteosarcoma	Associate	21751203, 25880599, 26510912, 30793707, 31425497
Osteosarcoma	Stimulate	8863670
Ovarian Diseases	Associate	27599579
Ovarian Neoplasms	Associate	23467907, 24952592, 25658794, 26695152, 26937756, 27599579, 28446239, 28829508, 29099290, 30638462
Pancreatic Neoplasms	Associate	11259105, 16804974, 18422749, 25451256, 26298849, 26381405, 29229329, 31161784, 31284422, 31911180, 35449152, 37108495, 9665487
Pancreatitis	Associate	16804974
Papillary renal cell carcinoma sporadic	Associate	10433944
Peritoneal Diseases	Associate	12524084
Peritonitis	Associate	25902175, 33655604
Personality Disorders	Stimulate	26225770
Pituitary Neoplasms	Associate	20200025
Placenta Diseases	Associate	9777945
Polycystic Ovary Syndrome	Associate	23036804
Polyposis Syndrome Hereditary Mixed 1	Associate	10944610
Precancerous Conditions	Associate	31233202
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	17673463
Prostatic Neoplasms	Associate	15274358, 20085644, 20200161, 22639908, 23877345, 24066029, 25990623, 26337460, 28440432, 30083962, 30551391, 32183146
Prostatic Neoplasms Castration Resistant	Stimulate	21365123
Prostatic Neoplasms Castration Resistant	Associate	27105539, 32183146, 32943461
Prostatitis	Associate	12707036
Proteinuria	Associate	30143691
Rectal Neoplasms	Associate	25875173, 31213644
Retinoblastoma	Associate	30030888, 30291212, 33245030
Rhabdomyosarcoma	Associate	21575221
Rhabdomyosarcoma Alveolar	Associate	21575221
Sarcoma	Associate	10702398, 8863670
Sarcoma Alveolar Soft Part	Associate	19146682, 32127467
Sarcoma Synovial	Associate	11487273
Schizophrenia	Associate	33986383
Scleroderma Systemic	Associate	21520010
Seminoma	Stimulate	30646583
Sick Sinus Syndrome	Associate	28590585
Skull Base Neoplasms	Associate	17948912
Small Cell Lung Carcinoma	Associate	19139719, 21043826, 21731696, 24827412
Solitary Fibrous Tumors	Associate	24353015
Squamous Cell Carcinoma of Head and Neck	Associate	15154624, 16612144, 22869872, 23213056, 23226095, 23371912, 27451021, 29360662, 31940827, 33655604, 36053327, 36184713
Stomach Neoplasms	Associate	15556605, 16609989, 18395971, 21777278, 22383989, 22606006, 22640970, 23372746, 23812675, 24393368, 25203738, 25592281, 26033401, 26260789, 26334097 View all (21 more)
Stomach Neoplasms	Stimulate	16244541
Tarlov Cysts	Associate	31161784, 35449152
Tertiary Lymphoid Structures	Associate	26459369, 34171074
Thrombocytopenia	Associate	37041472
Thyroid Cancer Papillary	Associate	14508824, 25868389, 29426928
Thyroid Diseases	Associate	30361909
Thyroid Neoplasms	Associate	22135723, 26044563
Thyroid Nodule	Associate	20558345, 30361909
Triple Negative Breast Neoplasms	Associate	27286449, 29843069, 29920512, 34863149, 37377890
Urinary Bladder Diseases	Associate	25178641
Urinary Bladder Neoplasms	Associate	23820886, 25405368, 26225770, 26844702, 31180621, 38132404
Uterine Cervical Neoplasms	Associate	23927384, 27049264, 32094378
Uveal melanoma	Associate	22419847, 25961751, 28138035, 29045509, 37955612, 9546344
Vascular Calcification	Associate	21920521
Vitreoretinopathy Proliferative	Associate	15156160, 27936052
Waardenburg Syndrome	Associate	10536986

MET (MET proto-oncogene, receptor tyrosine kinase)