Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4223
Gene name Gene Name - the full gene name approved by the HGNC.	Mesenchyme homeobox 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MEOX2
Synonyms (NCBI Gene) Gene synonyms aliases	GAX, MOX2
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7p21.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the regulation of vertebrate limb myogenesis. Mutations in the related mouse protein may be associate

Show/Hide all(78)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004358	hsa-miR-130a-3p	Luciferase reporter assay, qRT-PCR, Western blot, Northern blot	17957028
MIRT004358	hsa-miR-130a-3p	Review	19935707
MIRT003611	hsa-miR-301a-3p	Luciferase reporter assay	20470754
MIRT003611	hsa-miR-301a-3p	Luciferase reporter assay	20470754
MIRT003611	hsa-miR-301a-3p	Luciferase reporter assay, qRT-PCR, Western blot	22373864
MIRT003611	hsa-miR-301a-3p	Luciferase reporter assay, qRT-PCR, Western blot	22373864
MIRT003611	hsa-miR-301a-3p	Luciferase reporter assay, qRT-PCR, Western blot	22373864
MIRT003611	hsa-miR-301a-3p	Luciferase reporter assay, qRT-PCR, Western blot	22373864
MIRT003611	hsa-miR-301a-3p	Luciferase reporter assay, qRT-PCR, Western blot	22373864
MIRT003611	hsa-miR-301a-3p	Luciferase reporter assay, qRT-PCR, Western blot	22373864
MIRT018453	hsa-miR-335-5p	Microarray	18185580
MIRT004358	hsa-miR-130a-3p	Reporter assay;Other	17957028
MIRT024208	hsa-miR-221-3p	Western blot;qRT-PCR	20516212
MIRT044481	hsa-miR-320a	CLASH	23622248
MIRT714961	hsa-miR-1183	HITS-CLIP	19536157
MIRT714960	hsa-miR-138-1-3p	HITS-CLIP	19536157
MIRT714959	hsa-miR-4742-3p	HITS-CLIP	19536157
MIRT714958	hsa-miR-4684-5p	HITS-CLIP	19536157
MIRT714957	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT714956	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT714955	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT714961	hsa-miR-1183	HITS-CLIP	19536157
MIRT714960	hsa-miR-138-1-3p	HITS-CLIP	19536157
MIRT714959	hsa-miR-4742-3p	HITS-CLIP	19536157
MIRT714958	hsa-miR-4684-5p	HITS-CLIP	19536157
MIRT714957	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT714956	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT714955	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT714961	hsa-miR-1183	HITS-CLIP	19536157
MIRT714960	hsa-miR-138-1-3p	HITS-CLIP	19536157
MIRT714959	hsa-miR-4742-3p	HITS-CLIP	19536157
MIRT714958	hsa-miR-4684-5p	HITS-CLIP	19536157
MIRT714957	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT714956	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT714955	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT733710	hsa-miR-141-5p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), RNA-seq, qRT-PCR	33627047
MIRT714961	hsa-miR-1183	HITS-CLIP	19536157
MIRT714960	hsa-miR-138-1-3p	HITS-CLIP	19536157
MIRT714959	hsa-miR-4742-3p	HITS-CLIP	19536157
MIRT714958	hsa-miR-4684-5p	HITS-CLIP	19536157
MIRT714957	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT714956	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT714955	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT714961	hsa-miR-1183	HITS-CLIP	19536157
MIRT714960	hsa-miR-138-1-3p	HITS-CLIP	19536157
MIRT714959	hsa-miR-4742-3p	HITS-CLIP	19536157
MIRT714958	hsa-miR-4684-5p	HITS-CLIP	19536157
MIRT714957	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT714956	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT714955	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT714961	hsa-miR-1183	HITS-CLIP	19536157
MIRT714960	hsa-miR-138-1-3p	HITS-CLIP	19536157
MIRT714959	hsa-miR-4742-3p	HITS-CLIP	19536157
MIRT714958	hsa-miR-4684-5p	HITS-CLIP	19536157
MIRT714957	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT714956	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT714955	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT1142997	hsa-miR-219-5p	CLIP-seq
MIRT1142998	hsa-miR-4445	CLIP-seq
MIRT1142999	hsa-miR-4782-3p	CLIP-seq
MIRT1143000	hsa-miR-508-3p	CLIP-seq
MIRT1143001	hsa-miR-548ac	CLIP-seq
MIRT1143002	hsa-miR-548ae	CLIP-seq
MIRT1143003	hsa-miR-548aj	CLIP-seq
MIRT1143004	hsa-miR-548am	CLIP-seq
MIRT1143005	hsa-miR-548d-3p	CLIP-seq
MIRT1143006	hsa-miR-548x	CLIP-seq
MIRT1143007	hsa-miR-548z	CLIP-seq
MIRT1143008	hsa-miR-593	CLIP-seq
MIRT2040688	hsa-miR-1208	CLIP-seq
MIRT2040689	hsa-miR-412	CLIP-seq
MIRT2040690	hsa-miR-4318	CLIP-seq
MIRT2040691	hsa-miR-4420	CLIP-seq
MIRT2040688	hsa-miR-1208	CLIP-seq
MIRT2040689	hsa-miR-412	CLIP-seq
MIRT2040690	hsa-miR-4318	CLIP-seq
MIRT2040691	hsa-miR-4420	CLIP-seq
MIRT2270419	hsa-miR-4775	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
ZEB2	Repression	20516212

Show/Hide all(32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	17074759
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	17074759
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	17074759
GO:0001525	Process	Angiogenesis	IEA
GO:0001757	Process	Somite specification	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	22206000
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	16335786, 25416956, 25910212, 30886144, 31515488
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	22206000
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	16335786
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007519	Process	Skeletal muscle tissue development	IEA
GO:0016607	Component	Nuclear speck	IEA
GO:0043565	Function	Sequence-specific DNA binding	IDA	9073066
GO:0043565	Function	Sequence-specific DNA binding	IMP	22206000
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	17074759
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	17074759
GO:0060021	Process	Roof of mouth development	IEA
GO:0060173	Process	Limb development	IEA
GO:0061053	Process	Somite development	IBA
GO:0090051	Process	Negative regulation of cell migration involved in sprouting angiogenesis	IGI	20516212
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
600535	7014	ENSG00000106511

Protein

UniProt ID

P50222

Protein name

Homeobox protein MOX-2 (Growth arrest-specific homeobox) (Mesenchyme homeobox 2)

Protein function

Mesodermal transcription factor that plays a key role in somitogenesis and somitogenesis and limb muscle differentiation (By similarity). Required during limb development for normal appendicular muscle formation and for the normal regulation of

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00046	Homeodomain	188 → 244	Homeodomain	Domain

Sequence

MEHPLFGCLRSPHATAQGLHPFSQSSLALHGRSDHMSYPELSTSSSSCIIAGYPNEEGMF
ASQHHRGHHHHHHHHHHHHHQQQQHQALQTNWHLPQMSSPPSAARHSLCLQPDSGGPPEL
GSSPPVLCSNSSSLGSSTPTGAACAPGDYGRQALSPAEAEKRSGGKRKSDSSDSQEGNYK
SEVNSKPRKERTAFTKEQIRELEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRM
KWKRVKGGQQGAAAREKELVNVKKGTLLPSELSGIGAATLQQTGDSIANEDSHDSDHSSE
HAHL

Sequence length

304

Interactions

View interactions

MEOX2 (mesenchyme homeobox 2)