Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4223
Gene name Gene Name - the full gene name approved by the HGNC.
Mesenchyme homeobox 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MEOX2
Synonyms (NCBI Gene) Gene synonyms aliases
GAX, MOX2
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7p21.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the regulation of vertebrate limb myogenesis. Mutations in the related mouse protein may be associate
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004358 hsa-miR-130a-3p Luciferase reporter assay, qRT-PCR, Western blot, Northern blot 17957028
MIRT004358 hsa-miR-130a-3p Review 19935707
MIRT003611 hsa-miR-301a-3p Luciferase reporter assay 20470754
MIRT003611 hsa-miR-301a-3p Luciferase reporter assay 20470754
MIRT003611 hsa-miR-301a-3p Luciferase reporter assay, qRT-PCR, Western blot 22373864
Transcription factors
Transcription factor Regulation Reference
ZEB2 Repression 20516212
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 17074759
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600535 7014 ENSG00000106511
Protein
UniProt ID P50222
Protein name Homeobox protein MOX-2 (Growth arrest-specific homeobox) (Mesenchyme homeobox 2)
Protein function Mesodermal transcription factor that plays a key role in somitogenesis and somitogenesis and limb muscle differentiation (By similarity). Required during limb development for normal appendicular muscle formation and for the normal regulation of
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 188 244 Homeodomain Domain
Sequence
MEHPLFGCLRSPHATAQGLHPFSQSSLALHGRSDHMSYPELSTSSSSCIIAGYPNEEGMF
ASQHHRGHHHHHHHHHHHHHQQQQHQALQTNWHLPQMSSPPSAARHSLCLQPDSGGPPEL
GSSPPVLCSNSSSLGSSTPTGAACAPGDYGRQALSPAEAEKRSGGKRKSDSSDSQEGNYK
SEVNSKPRKERTAFTKEQIRELEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRM
KWKR
VKGGQQGAAAREKELVNVKKGTLLPSELSGIGAATLQQTGDSIANEDSHDSDHSSE
HAHL
Sequence length 304
Interactions View interactions