Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4211
Gene name Gene Name - the full gene name approved by the HGNC.
Meis homeobox 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MEIS1
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p14
Summary Summary of gene provided in NCBI Entrez Gene.
Homeobox genes, of which the most well-characterized category is represented by the HOX genes, play a crucial role in normal development. In addition, several homeoproteins are involved in neoplasia. This gene encodes a homeobox protein belonging to the T
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT000189 hsa-miR-204-5p Review 20029422
MIRT000287 hsa-miR-155-5p Luciferase reporter assay, qRT-PCR, Western blot 18950466
MIRT004962 hsa-let-7a-5p qRT-PCR 17942906
MIRT004946 hsa-miR-98-5p qRT-PCR 17942906
MIRT000189 hsa-miR-204-5p Luciferase reporter assay, Microarray, Western blot 18308931
Transcription factors
Transcription factor Regulation Reference
ELF1 Activation 20600580
PBX2 Unknown 24617557
PKNOX1 Unknown 12732210
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601739 7000 ENSG00000143995
Protein
UniProt ID O00470
Protein name Homeobox protein Meis1
Protein function Acts as a transcriptional regulator of PAX6. Acts as a transcriptional activator of PF4 in complex with PBX1 or PBX2. Required for hematopoiesis, megakaryocyte lineage development and vascular patterning. May function as a cofactor for HOXA7 and
PDB 4XRS , 5EGO
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16493 Meis_PKNOX_N 108 192 N-terminal of Homeobox Meis and PKNOX1 Family
PF05920 Homeobox_KN 290 329 Homeobox KN domain Family
Tissue specificity TISSUE SPECIFICITY: Expressed at low level in normal immunohepatopoietic tissues, including the fetal liver. Expressed in a subset of myeloid leukemia cell lines, with the highest expression seen in those with a megakaryocytic-erythroid phenotype. Also ex
Sequence
MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMA
PSMGSSVNDALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNED
IAVFAKQIRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGK
MPIDLVIDDREG
GSKSDSEDITRSANLTDQPSWNRDHDDTASTRSGGTPGPSSGGHTSHS
GDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYP
SEEQKKQLAQDTGLTILQVNNWFINARRR
IVQPMIDQSNRAVSQGTPYNPDGQPMGGFVM
DGQQHMGIRAPGPMSGMGMNMGMEGQWHYM
Sequence length 390
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Signaling pathways regulating pluripotency of stem cells
Transcriptional misregulation in cancer
 
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Colorectal Cancer Colorectal cancer N/A N/A GWAS
Diabetes Type 2 diabetes N/A N/A GWAS
Endometriosis Endometriosis N/A N/A GWAS
Insomnia Insomnia complaints, Insomnia complaints (continuous), Insomnia complaints (dichotomous), Insomnia (PheCode 327.4), Insomnia, Insomnia (standard GWA) N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 26035298, 33979320
Adrenocortical Carcinoma Associate 33776902
Breast Neoplasms Associate 19776672
Carcinoma Squamous Cell Associate 22143938
Cardiomyopathy Hypertrophic Associate 33757590
Cardiovascular Diseases Associate 28425489
Colonic Neoplasms Associate 24244575
Colorectal Neoplasms Associate 24244575
Emanuel syndrome Associate 35981137
Esophageal Squamous Cell Carcinoma Inhibit 26314854