Gene Gene information from NCBI Gene database.
Entrez ID 4211
Gene name Meis homeobox 1
Gene symbol MEIS1
Synonyms (NCBI Gene)
-
Chromosome 2
Chromosome location 2p14
Summary Homeobox genes, of which the most well-characterized category is represented by the HOX genes, play a crucial role in normal development. In addition, several homeoproteins are involved in neoplasia. This gene encodes a homeobox protein belonging to the T
miRNA miRNA information provided by mirtarbase database.
353
miRTarBase ID miRNA Experiments Reference
MIRT000189 hsa-miR-204-5p Review 20029422
MIRT000287 hsa-miR-155-5p Luciferase reporter assayqRT-PCRWestern blot 18950466
MIRT004962 hsa-let-7a-5p qRT-PCR 17942906
MIRT004946 hsa-miR-98-5p qRT-PCR 17942906
MIRT000189 hsa-miR-204-5p Luciferase reporter assayMicroarrayWestern blot 18308931
Transcription factors Transcription factors information provided by TRRUST V2 database.
3
Transcription factor Regulation Reference
ELF1 Activation 20600580
PBX2 Unknown 24617557
PKNOX1 Unknown 12732210
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
35
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601739 7000 ENSG00000143995
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O00470
Protein name Homeobox protein Meis1
Protein function Acts as a transcriptional regulator of PAX6. Acts as a transcriptional activator of PF4 in complex with PBX1 or PBX2. Required for hematopoiesis, megakaryocyte lineage development and vascular patterning. May function as a cofactor for HOXA7 and
PDB 4XRS , 5EGO
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16493 Meis_PKNOX_N 108 192 N-terminal of Homeobox Meis and PKNOX1 Family
PF05920 Homeobox_KN 290 329 Homeobox KN domain Family
Tissue specificity TISSUE SPECIFICITY: Expressed at low level in normal immunohepatopoietic tissues, including the fetal liver. Expressed in a subset of myeloid leukemia cell lines, with the highest expression seen in those with a megakaryocytic-erythroid phenotype. Also ex
Sequence
MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMA
PSMGSSVNDALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNED
IAVFAKQIRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGK
MPIDLVIDDREG
GSKSDSEDITRSANLTDQPSWNRDHDDTASTRSGGTPGPSSGGHTSHS
GDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYP
SEEQKKQLAQDTGLTILQVNNWFINARRR
IVQPMIDQSNRAVSQGTPYNPDGQPMGGFVM
DGQQHMGIRAPGPMSGMGMNMGMEGQWHYM
Sequence length 390
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  Signaling pathways regulating pluripotency of stem cells
Transcriptional misregulation in cancer
 
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
MEIS1-related disorder Likely benign rs375684991 RCV003976850
See cases Uncertain significance rs1675410948 RCV001196319
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 26035298, 33979320
Adrenocortical Carcinoma Associate 33776902
Breast Neoplasms Associate 19776672
Carcinoma Squamous Cell Associate 22143938
Cardiomyopathy Hypertrophic Associate 33757590
Cardiovascular Diseases Associate 28425489
Colonic Neoplasms Associate 24244575
Colorectal Neoplasms Associate 24244575
Emanuel syndrome Associate 35981137
Esophageal Squamous Cell Carcinoma Inhibit 26314854