Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4210
Gene name Gene Name - the full gene name approved by the HGNC.
MEFV innate immunity regulator, pyrin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MEFV
Synonyms (NCBI Gene) Gene synonyms aliases
FMF, MEF, PAAND, TRIM20
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein, also known as pyrin or marenostrin, that is an important modulator of innate immunity. Mutations in this gene are associated with Mediterranean fever, a hereditary periodic fever syndrome. [provided by RefSeq, Jul 2008]
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs3743930 C>A,G,T Conflicting-interpretations-of-pathogenicity, uncertain-significance, pathogenic Missense variant, stop gained, non coding transcript variant, intron variant, coding sequence variant
rs11466016 C>A Conflicting-interpretations-of-pathogenicity, uncertain-significance Missense variant, non coding transcript variant, coding sequence variant
rs11466018 A>G Conflicting-interpretations-of-pathogenicity, likely-benign Missense variant, non coding transcript variant, intron variant, coding sequence variant
rs11466023 G>A,T Conflicting-interpretations-of-pathogenicity, uncertain-significance Missense variant, non coding transcript variant, coding sequence variant
rs11466024 C>A,T Conflicting-interpretations-of-pathogenicity, uncertain-significance Missense variant, non coding transcript variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT733341 hsa-miR-197-3p ELISA, qRT-PCR 33436947
MIRT1142346 hsa-miR-1827 CLIP-seq
MIRT1142347 hsa-miR-3122 CLIP-seq
MIRT1142348 hsa-miR-3147 CLIP-seq
MIRT1142349 hsa-miR-3160-3p CLIP-seq
Transcription factors
Transcription factor Regulation Reference
E2F1 Activation 20805247
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001726 Component Ruffle IEA
GO:0002221 Process Pattern recognition receptor signaling pathway NAS 29196474
GO:0002376 Process Immune system process IEA
GO:0003779 Function Actin binding IDA 11468188
GO:0003779 Function Actin binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608107 6998 ENSG00000103313
Protein
UniProt ID O15553
Protein name Pyrin (Marenostrin)
Protein function Involved in the regulation of innate immunity and the inflammatory response in response to IFNG/IFN-gamma (PubMed:10807793, PubMed:11468188, PubMed:16037825, PubMed:16785446, PubMed:17431422, PubMed:17964261, PubMed:18577712, PubMed:19109554, Pu
PDB 2MPC , 2WL1 , 4CG4 , 8C28 , 8C2Y , 8C30 , 8SDJ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02758 PYRIN 8 84 PAAD/DAPIN/Pyrin domain Domain
PF00643 zf-B_box 370 412 B-box zinc finger Domain
PF13765 PRY 600 648 SPRY-associated domain Family
PF00622 SPRY 652 771 SPRY domain Family
Tissue specificity TISSUE SPECIFICITY: Expressed in peripheral blood leukocytes, particularly in mature granulocytes and to a lesser extent in monocytes but not in lymphocytes. Detected in spleen, lung and muscle, probably as a result of leukocyte infiltration in these tiss
Sequence
MAKTPSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSRIPRSQIQRARPVKMATLLVTY
YGEEYAVQLTLQVLRAINQRLLAE
ELHRAAIQEYSTQENGTDDSAASSSLGENKPRSLKT
PDHPEGNEGNGPRPYGGGAASLRCSQPEAGRGLSRKPLSKRREKASEGLDAQGKPRTRSP
ALPGGRSPGPCRALEGGQAEVRLRRNASSAGRLQGLAGGAPGQKECRPFEVYLPSGKMRP
RSLEVTISTGEKAPANPEILLTLEEKTAANLDSATEPRARPTPDGGASADLKEGPGNPEH
SVTGRPPDTAASPRCHAQEGDPVDGTCVRDSCSFPEAVSGHPQASGSRSPGCPRCQDSHE
RKSPGSLSPQPLPQCKRHLKQVQLLFCEDHDEPICLICSLSQEHQGHRVRPIEEVALEHK
KKIQKQLEHLKKLRKSGEEQRSYGEEKAVSFLKQTEALKQRVQRKLEQVYYFLEQQEHFF
VASLEDVGQMVGQIRKAYDTRVSQDIALLDALIGELEAKECQSEWELLQDIGDILHRAKT
VPVPEKWTTPQEIKQKIQLLHQKSEFVEKSTKYFSETLRSEMEMFNVPELIGAQAHAVNV
ILDAETAYPNLIFSDDLKSVRLGNKWERLPDGPQRFDSCIIVLGSPSF
LSGRRYWEVEVG
DKTAWILGACKTSISRKGNMTLSPENGYWVVIMMKENEYQASSVPPTRLLIKEPPKRVGI
FVDYRVGSISFYNVTARSHIYTFASCSFSGPLQPIFSPGTRDGGKNTAPLT
ICPVGGQGP
D
Sequence length 781
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  NOD-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Yersinia infection
  The NLRP3 inflammasome
Purinergic signaling in leishmaniasis infection
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Autoinflammatory Disease Autoinflammatory syndrome rs104895093, rs28940578, rs28940580 N/A
Behcet Syndrome Behcet disease rs751454741 N/A
neuronal ceroid lipofuscinosis Neuronal ceroid lipofuscinosis rs104895127 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Ankylosing Spondylitis Ankylosing spondylitis N/A N/A GWAS
Myopathy Central core myopathy N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
AA amyloidosis Associate 17469185, 23461592, 37738242
Abdomen Acute Associate 19820675
Abdominal Injuries Associate 35812376
Abdominal Pain Associate 15458961, 21978701, 25073670, 25626331, 26759267, 31627741, 31804137, 34098104
Acute Disease Inhibit 17195238
Amyloidosis Associate 11156548, 12687559, 12929299, 15018633, 15458961, 19797919, 22318840, 22705602, 25394530, 28781304, 28859624, 31603074, 34692839
Amyloidosis familial visceral Associate 10364520, 11017802, 12687559, 17469185, 19888326, 23038988, 23907647, 28859624
Arthralgia Associate 15458961, 18300119, 26759267, 27026266, 27030597, 31804137, 35812376
Arthritis Associate 10364520, 15458961, 18300119, 23206577, 23907647, 26759267, 29642170, 30299251, 31171010, 32778116, 34098104
Arthritis Juvenile Associate 18576390, 23907647, 30847869, 30940621, 32398039, 32894151