Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4209
Gene name Gene Name - the full gene name approved by the HGNC.
Myocyte enhancer factor 2D
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MEF2D
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q22
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of the myocyte-specific enhancer factor 2 (MEF2) family of transcription factors. Members of this family are involved in control of muscle and neuronal cell differentiation and development, and are regulated by class II histone deace
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT003015 hsa-miR-17-5p Luciferase reporter assay 19666108
MIRT003015 hsa-miR-17-5p Luciferase reporter assay 19666108
MIRT003012 hsa-miR-20a-5p Luciferase reporter assay 19666108
MIRT003012 hsa-miR-20a-5p Luciferase reporter assay 19666108
MIRT027395 hsa-miR-99a-5p Sequencing 20371350
Transcription factors
Transcription factor Regulation Reference
HDAC7 Repression 11585834
JUN Activation 12054430
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 20590529
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IDA 20590529
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600663 6997 ENSG00000116604
Protein
UniProt ID Q14814
Protein name Myocyte-specific enhancer factor 2D
Protein function Transcriptional activator which binds specifically to the MEF2 element, 5'-YTA[AT](4)TAR-3', found in numerous muscle-specific, growth factor- and stress-induced genes. Mediates cellular functions not only in skeletal and cardiac muscle developm
PDB 7X1N , 8C84
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00319 SRF-TF 10 57 SRF-type transcription factor (DNA-binding and dimerisation domain) Domain
PF12347 HJURP_C 90 154 Holliday junction regulator protein family C-terminal repeat Domain
Sequence
MGRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHSNKLFQYAST
DMDKVLLKYTEYNEPHESRTNADIIETLRKKGFNGCDSPEPDGEDSLEQSPLLEDKYRRA
SEELDGLFRRYGSTVPAPNFAMPVTVPVSNQSSL
QFSNPSGSLVTPSLVTSSLTDPRLLS
PQQPALQRNSVSPGLPQRPASAGAMLGGDLNSANGACPSPVGNGYVSARASPGLLPVANG
NSLNKVIPAKSPPPPTHSTQLGAPSRKPDLRVITSQAGKGLMHHLTEDHLDLNNAQRLGV
SQSTHSLTTPVVSVATPSLLSQGLPFSSMPTAYNTDYQLTSAELSSLPAFSSPGGLSLGN
VTAWQQPQQPQQPQQPQPPQQQPPQPQQPQPQQPQQPQQPPQQQSHLVPVSLSNLIPGSP
LPHVGAALTVTTHPHISIKSEPVSPSRERSPAPPPPAVFPAARPEPGDGLSSPAGGSYET
GDRDDGRGDFGPTLGLLRPAPEPEAEGSAVKRMRLDTWTLK
Sequence length 521
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  cGMP-PKG signaling pathway
Apelin signaling pathway
Parathyroid hormone synthesis, secretion and action
  Transcriptional activation of mitochondrial biogenesis
Circadian Clock
Myogenesis
NGF-stimulated transcription
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Migraine Migraine Disorders rs794727411 27322543, 23793025, 22683712, 27182965
Unknown
Disease term Disease name Evidence References Source
Heart Failure Heart Failure GWAS
Associations from Text Mining
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 26164003, 34876040
Carcinoma Non Small Cell Lung Associate 28340574, 40589937
Carcinoma Renal Cell Associate 30171027
Death Associate 30171027
Epstein Barr Virus Infections Associate 37958849
Gallbladder Neoplasms Stimulate 31799650
Glioblastoma Associate 23421905
Glomerulonephritis IGA Associate 35769467
Hematologic Neoplasms Associate 15182431
Inflammation Stimulate 28340574