Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4208
Gene name Gene Name - the full gene name approved by the HGNC.
Myocyte enhancer factor 2C
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MEF2C
Synonyms (NCBI Gene) Gene synonyms aliases
C5DELq14.3, DEL5q14.3, NEDHSIL
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q14.3
Summary Summary of gene provided in NCBI Entrez Gene.
This locus encodes a member of the MADS box transcription enhancer factor 2 (MEF2) family of proteins, which play a role in myogenesis. The encoded protein, MEF2 polypeptide C, has both trans-activating and DNA binding activities. This protein may play a
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs267607233 G>C Pathogenic Coding sequence variant, stop gained
rs397514655 A>G,T Pathogenic Genic upstream transcript variant, coding sequence variant, missense variant
rs397514656 C>G Pathogenic Genic upstream transcript variant, coding sequence variant, missense variant
rs398123686 G>A Uncertain-significance, likely-benign, conflicting-interpretations-of-pathogenicity Coding sequence variant, synonymous variant
rs545185248 A>G,T Pathogenic Genic upstream transcript variant, initiator codon variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT000128 hsa-miR-223-3p Luciferase reporter assay 18278031
MIRT000128 hsa-miR-223-3p Review 20029422
MIRT005737 hsa-miR-21-5p Immunofluorescence, In situ hybridization, Luciferase reporter assay 21170291
MIRT005737 hsa-miR-21-5p Immunofluorescence, In situ hybridization, Luciferase reporter assay 21170291
MIRT000128 hsa-miR-223-3p Immunofluorescence, qRT-PCR, Western blot 23094093
Transcription factors
Transcription factor Regulation Reference
GFI1B Repression 21261500
HDAC7 Repression 11585834
HIPK2 Repression 23620283
ISL1 Activation 23152444
NKX2-5 Repression 21261500
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 18079734
GO:0000165 Process MAPK cascade IDA 9858528
GO:0000165 Process MAPK cascade IMP 11160896
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription cis-regulatory region binding ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600662 6996 ENSG00000081189
Protein
UniProt ID Q06413
Protein name Myocyte-specific enhancer factor 2C (Myocyte enhancer factor 2C)
Protein function Transcription activator which binds specifically to the MEF2 element present in the regulatory regions of many muscle-specific genes. Controls cardiac morphogenesis and myogenesis, and is also involved in vascular development. Enhances transcrip
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00319 SRF-TF 10 57 SRF-type transcription factor (DNA-binding and dimerisation domain) Domain
PF12347 HJURP_C 90 155 Holliday junction regulator protein family C-terminal repeat Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in brain and skeletal muscle. {ECO:0000269|PubMed:9798649}.
Sequence
MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYAST
DMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCDSPDPDADDSVGHSPESEDKYRKI
NEDIDLMISRQRLCAVPPPNFEMPVSIPVSSHNSL
VYSNPVSSLGNPNLLPLAHPSLQRN
SMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKS
PPPMNLGMNNRKPDLRVLIPPGSKNTMPSVSEDVDLLLNQRINNSQSAQSLATPVVSVAT
PTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVTGWQQQHLHNMPP
SALSQLGACTSTHLSQSSNLSLPSTQSLNIKSEPVSPPRDRTTTPSRYPQHTRHEAGRSP
VDSLSSCSSSYDGSDREDHRNEFHSPIGLTRPSPDERESPSVKRMRLSEGWAT
Sequence length 473
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  MAPK signaling pathway
cGMP-PKG signaling pathway
Apelin signaling pathway
Oxytocin signaling pathway
Parathyroid hormone synthesis, secretion and action
Transcriptional misregulation in cancer
Fluid shear stress and atherosclerosis
  Transcriptional activation of mitochondrial biogenesis
Circadian Clock
Myogenesis
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Frontotemporal dementia frontotemporal dementia rs1085307051 N/A
Mental retardation Intellectual disability, autosomal dominant 20, intellectual disability rs1759964009, rs1554150543, rs796052733, rs1554102556, rs1554150552, rs796052724, rs267607233, rs1561697465, rs397514655, rs796052728, rs1561875779, rs2147483647, rs797045053, rs1581338441, rs397514656
View all (8 more)
N/A
autism spectrum disorder Autism spectrum disorder rs796052733, rs1561824498, rs796052728 N/A
Epileptic encephalopathy epileptic encephalopathy rs1580990072 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Atrial Fibrillation Atrial fibrillation N/A N/A GWAS
Attention Deficit Hyperactivity Disorder Attention deficit hyperactivity disorder N/A N/A GWAS
Insomnia Insomnia N/A N/A GWAS
Mental Depression Major depressive disorder N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 33982215, 35710690
Alzheimer Disease Associate 25114068, 25723573, 28199971, 34103633, 34767070, 35563596
Alzheimer Disease Inhibit 29112298
Aphasia Associate 31375103
Atherosclerosis Associate 26184978
Attention Deficit Disorder with Hyperactivity Associate 29413154, 36774336
Autism Spectrum Disorder Associate 28533427, 30763456, 39259737
Autistic Disorder Associate 30376817
Brain Ischemia Stimulate 22363514
Breast Neoplasms Associate 21939504, 33673112, 36128051