Gene Gene information from NCBI Gene database.
Entrez ID 4189
Gene name DnaJ heat shock protein family (Hsp40) member B9
Gene symbol DNAJB9
Synonyms (NCBI Gene)
ERdj4MDG-1MDG1MST049MSTP049
Chromosome 7
Chromosome location 7q31.1|14q24.2-q24.3
Summary This gene is a member of the J protein family. J proteins function in many cellular processes by regulating the ATPase activity of 70 kDa heat shock proteins. This gene is a member of the type 2 subgroup of DnaJ proteins. The encoded protein is localized
miRNA miRNA information provided by mirtarbase database.
1134
miRTarBase ID miRNA Experiments Reference
MIRT017907 hsa-miR-335-5p Microarray 18185580
MIRT024579 hsa-miR-215-5p Microarray 19074876
MIRT026471 hsa-miR-192-5p Microarray 19074876
MIRT028383 hsa-miR-32-5p Sequencing 20371350
MIRT044516 hsa-miR-320a CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
26
GO ID Ontology Definition Evidence Reference
GO:0002639 Process Positive regulation of immunoglobulin production IEA
GO:0002639 Process Positive regulation of immunoglobulin production ISS
GO:0005515 Function Protein binding IPI 19815549, 33961781
GO:0005730 Component Nucleolus ISS
GO:0005737 Component Cytoplasm ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602634 6968 ENSG00000128590
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UBS3
Protein name DnaJ homolog subfamily B member 9 (Endoplasmic reticulum DNA J domain-containing protein 4) (ER-resident protein ERdj4) (ERdj4) (Microvascular endothelial differentiation gene 1 protein) (Mdg-1)
Protein function Co-chaperone for Hsp70 protein HSPA5/BiP that acts as a key repressor of the ERN1/IRE1-mediated unfolded protein response (UPR) (By similarity). J domain-containing co-chaperones stimulate the ATPase activity of Hsp70 proteins and are required f
PDB 2CTR
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00226 DnaJ 26 87 DnaJ domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Expressed at highest level in the liver, placenta and kidney (PubMed:11836248). {ECO:0000269|PubMed:11836248}.
Sequence
MATPQSIFIFAICILMITELILASKSYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKS
PDAEAKFREIAEAYETLSDANRRKEYD
TLGHSAFTSGKGQRGSGSSFEQSFNFNFDDLFK
DFGFFGQNQNTGSKKRFENHFQTRQDGGSSRQRHHFQEFSFGGGLFDDMFEDMEKMFSFS
GFDSTNQHTVQTENRFHGSSKHCRTVTQRRGNMVTTYTDCSGQ
Sequence length 223
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    XBP1(S) activates chaperone genes