DNAJB9 (DnaJ heat shock protein family (Hsp40) member B9)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4189
Gene name Gene Name - the full gene name approved by the HGNC.
DnaJ heat shock protein family (Hsp40) member B9
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DNAJB9
Synonyms (NCBI Gene) Gene synonyms aliases
ERdj4, MDG-1, MDG1, MST049, MSTP049
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q31.1|14q24.2-q24.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of the J protein family. J proteins function in many cellular processes by regulating the ATPase activity of 70 kDa heat shock proteins. This gene is a member of the type 2 subgroup of DnaJ proteins. The encoded protein is localized
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(1134)
miRTarBase ID miRNA Experiments Reference
MIRT017907 hsa-miR-335-5p Microarray 18185580
MIRT024579 hsa-miR-215-5p Microarray 19074876
MIRT026471 hsa-miR-192-5p Microarray 19074876
MIRT028383 hsa-miR-32-5p Sequencing 20371350
MIRT044516 hsa-miR-320a CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(26)
GO ID Ontology Definition Evidence Reference
GO:0002639 Process Positive regulation of immunoglobulin production IEA
GO:0002639 Process Positive regulation of immunoglobulin production ISS
GO:0005515 Function Protein binding IPI 19815549, 33961781
GO:0005730 Component Nucleolus ISS
GO:0005737 Component Cytoplasm ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
602634 6968 ENSG00000128590
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q9UBS3
Protein name DnaJ homolog subfamily B member 9 (Endoplasmic reticulum DNA J domain-containing protein 4) (ER-resident protein ERdj4) (ERdj4) (Microvascular endothelial differentiation gene 1 protein) (Mdg-1)
Protein function Co-chaperone for Hsp70 protein HSPA5/BiP that acts as a key repressor of the ERN1/IRE1-mediated unfolded protein response (UPR) (By similarity). J domain-containing co-chaperones stimulate the ATPase activity of Hsp70 proteins and are required f
PDB 2CTR
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00226 DnaJ 26 → 87 DnaJ domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Expressed at highest level in the liver, placenta and kidney (PubMed:11836248). {ECO:0000269|PubMed:11836248}.
Sequence 
MATPQSIFIFAICILMITELILASKSYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKS
PDAEAKFREIAEAYETLSDANRRKEYDTLGHSAFTSGKGQRGSGSSFEQSFNFNFDDLFK
DFGFFGQNQNTGSKKRFENHFQTRQDGGSSRQRHHFQEFSFGGGLFDDMFEDMEKMFSFS
GFDSTNQHTVQTENRFHGSSKHCRTVTQRRGNMVTTYTDCSGQ
Sequence length 223
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    XBP1(S) activates chaperone genes
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Insomnia Insomnia N/A N/A GWAS
Show/Hide Text Mining Associations (9)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenomatous Polyps Associate 22020530
Amyotrophic Lateral Sclerosis Associate 29725981
Carcinoma Ovarian Epithelial Associate 33676525
Colorectal Neoplasms Associate 22020530
Glioblastoma Associate 37561833, 39652629
Intervertebral Disc Degeneration Associate 38041088
Leukemia Myeloid Acute Associate 31884339
Lymphoma Non Hodgkin Associate 29725981
Parkinson Disease Associate 30833663