Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4175
Gene name	Minichromosome maintenance complex component 6
Gene symbol	MCM6
Synonyms (NCBI Gene)	MCG40308Mis5P105MCM
Chromosome	2
Chromosome location	2q21.3
Summary	The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component

Show/Hide all (69)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016611	hsa-miR-193b-3p	Microarray	20304954
MIRT016611	hsa-miR-193b-3p	Proteomics	21512034
MIRT024027	hsa-miR-1-3p	Proteomics	18668040
MIRT024879	hsa-miR-215-5p	Microarray	19074876
MIRT025545	hsa-miR-34a-5p	Proteomics	21566225
MIRT026808	hsa-miR-192-5p	Microarray	19074876
MIRT035931	hsa-miR-1180-3p	CLASH	23622248
MIRT1137756	hsa-miR-1178	CLIP-seq
MIRT1137757	hsa-miR-1197	CLIP-seq
MIRT1137758	hsa-miR-1302	CLIP-seq
MIRT1137759	hsa-miR-3128	CLIP-seq
MIRT1137760	hsa-miR-329	CLIP-seq
MIRT1137761	hsa-miR-3619-3p	CLIP-seq
MIRT1137762	hsa-miR-362-3p	CLIP-seq
MIRT1137763	hsa-miR-369-3p	CLIP-seq
MIRT1137764	hsa-miR-374a	CLIP-seq
MIRT1137765	hsa-miR-374b	CLIP-seq
MIRT1137766	hsa-miR-4261	CLIP-seq
MIRT1137767	hsa-miR-4298	CLIP-seq
MIRT1137768	hsa-miR-4420	CLIP-seq
MIRT1137769	hsa-miR-4496	CLIP-seq
MIRT1137770	hsa-miR-4679	CLIP-seq
MIRT1137771	hsa-miR-4775	CLIP-seq
MIRT1137772	hsa-miR-4786-3p	CLIP-seq
MIRT1137773	hsa-miR-4789-3p	CLIP-seq
MIRT1137774	hsa-miR-487a	CLIP-seq
MIRT1137775	hsa-miR-548l	CLIP-seq
MIRT1137776	hsa-miR-548n	CLIP-seq
MIRT1137777	hsa-miR-548t	CLIP-seq
MIRT1137778	hsa-miR-553	CLIP-seq
MIRT1137779	hsa-miR-590-3p	CLIP-seq
MIRT1137780	hsa-miR-642b	CLIP-seq
MIRT1137781	hsa-miR-649	CLIP-seq
MIRT1137756	hsa-miR-1178	CLIP-seq
MIRT1137757	hsa-miR-1197	CLIP-seq
MIRT1137773	hsa-miR-4789-3p	CLIP-seq
MIRT2039120	hsa-miR-570	CLIP-seq
MIRT2269164	hsa-miR-149	CLIP-seq
MIRT2269165	hsa-miR-3064-5p	CLIP-seq
MIRT2269166	hsa-miR-4794	CLIP-seq
MIRT2269167	hsa-miR-604	CLIP-seq
MIRT2269168	hsa-miR-647	CLIP-seq
MIRT2269169	hsa-miR-767-3p	CLIP-seq
MIRT2568407	hsa-miR-3180-5p	CLIP-seq
MIRT2568408	hsa-miR-3182	CLIP-seq
MIRT1137761	hsa-miR-3619-3p	CLIP-seq
MIRT2568409	hsa-miR-3690	CLIP-seq
MIRT2568410	hsa-miR-4254	CLIP-seq
MIRT2568411	hsa-miR-4643	CLIP-seq
MIRT2568412	hsa-miR-4762-3p	CLIP-seq
MIRT2568413	hsa-miR-4766-5p	CLIP-seq
MIRT1137773	hsa-miR-4789-3p	CLIP-seq
MIRT2568414	hsa-miR-520a-5p	CLIP-seq
MIRT2568415	hsa-miR-525-5p	CLIP-seq
MIRT2039120	hsa-miR-570	CLIP-seq
MIRT2568416	hsa-miR-578	CLIP-seq
MIRT1137780	hsa-miR-642b	CLIP-seq
MIRT2568417	hsa-miR-671-5p	CLIP-seq
MIRT2568418	hsa-miR-766	CLIP-seq
MIRT1137761	hsa-miR-3619-3p	CLIP-seq
MIRT2568409	hsa-miR-3690	CLIP-seq
MIRT2568410	hsa-miR-4254	CLIP-seq
MIRT2568412	hsa-miR-4762-3p	CLIP-seq
MIRT2568413	hsa-miR-4766-5p	CLIP-seq
MIRT1137773	hsa-miR-4789-3p	CLIP-seq
MIRT2039120	hsa-miR-570	CLIP-seq
MIRT2568416	hsa-miR-578	CLIP-seq
MIRT1137780	hsa-miR-642b	CLIP-seq
MIRT2568417	hsa-miR-671-5p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
MYCN	Activation	17826980

Show/Hide all (39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000727	Process	Double-strand break repair via break-induced replication	IBA
GO:0000781	Component	Chromosome, telomeric region	HDA	19135898
GO:0003677	Function	DNA binding	IEA
GO:0003678	Function	DNA helicase activity	IDA	9305914, 25661590
GO:0003678	Function	DNA helicase activity	IEA
GO:0003678	Function	DNA helicase activity	IEA
GO:0003697	Function	Single-stranded DNA binding	IDA	25661590
GO:0003697	Function	Single-stranded DNA binding	IEA
GO:0003697	Function	Single-stranded DNA binding	ISS
GO:0004386	Function	Helicase activity	IEA
GO:0005515	Function	Protein binding	IPI	11095689, 15232106, 16189514, 16438930, 16899510, 16902406, 17296731, 17955473, 20202939, 20211142, 21653829, 22190034, 22540012, 23764002, 24299456, 25036637, 25416956, 26167883, 26496610, 28514442, 29290612, 29426014, 33654309, 33961781, 35271311
GO:0005524	Function	ATP binding	IEA
GO:0005524	Function	ATP binding	NAS	9286856
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	16899510, 22474384
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	9286856
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006260	Process	DNA replication	IDA	22474384
GO:0006260	Process	DNA replication	IEA
GO:0006260	Process	DNA replication	IEA
GO:0006260	Process	DNA replication	NAS	9286856
GO:0006270	Process	DNA replication initiation	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0030174	Process	Regulation of DNA-templated DNA replication initiation	NAS	30069701
GO:0042555	Component	MCM complex	IBA
GO:0042555	Component	MCM complex	IDA	17296731, 25661590
GO:0042555	Component	MCM complex	IEA
GO:0042555	Component	MCM complex	IPI	22540012
GO:0042802	Function	Identical protein binding	IPI	15232106, 16189514
GO:0071162	Component	CMG complex	IPI	22474384
GO:0071162	Component	CMG complex	ISS
GO:1902969	Process	Mitotic DNA replication	IBA
GO:1990518	Function	Single-stranded 3'-5' DNA helicase activity	IBA

MIM	HGNC	e!Ensembl
601806	6949	ENSG00000076003

Q14566

Protein name

DNA replication licensing factor MCM6 (EC 3.6.4.12) (p105MCM)

Protein function

Acts as a component of the MCM2-7 complex (MCM complex) which is the replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. Core component of CDC45-MCM-GINS (CMG) helicase, the mol

PDB

2KLQ , 2LE8 , 6XTX , 6XTY , 7PFO , 7PLO , 7W1Y , 7W68 , 8B9D , 8RWV , 8S09 , 8S0A , 8S0B , 8S0D , 8S0E , 8S0F , 8W0E , 8W0F , 8W0G , 8W0I , 9CAQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14551	MCM_N	27 → 127	MCM N-terminal domain	Domain
PF17207	MCM_OB	122 → 252	MCM OB domain	Domain
PF00493	MCM	333 → 556	MCM P-loop domain	Domain
PF17855	MCM_lid	570 → 656	MCM AAA-lid domain	Domain
PF18263	MCM6_C	711 → 819	MCM6 C-terminal winged-helix domain	Domain

Sequence

MDLAAAAEPGAGSQHLEVRDEVAEKCQKLFLDFLEEFQSSDGEIKYLQLAEELIRPERNT
LVVSFVDLEQFNQQLSTTIQEEFYRVYPYLCRALKTFVKDRKEIPLAKDFYVAFQDLPTR
HKIRELTSSRIGLLTRISGQVVRTHPVHPELVSGTFLCLDCQTVIRDVEQQFKYTQPNIC
RNPVCANRRRFLLDTNKSRFVDFQKVRIQETQAELPRGSIPRSLEVILRAEAVESAQAGD
KCDFTGTLIVVPDVSKLSTPGARAETNSRVSGVDGYETEGIRGLRALGVRDLSYRLVFLA
CCVAPTNPRFGGKELRDEEQTAESIKNQMTVKEWEKVFEMSQDKNLYHNLCTSLFPTIHG
NDEVKRGVLLMLFGGVPKTTGEGTSLRGDINVCIVGDPSTAKSQFLKHVEEFSPRAVYTS
GKASSAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMDVRDQVAIHEAMEQQ
TISITKAGVKATLNARTSILAAANPISGHYDRSKSLKQNINLSAPIMSRFDLFFILVDEC
NEVTDYAIARRIVDLHSRIEESIDRVYSLDDIRRYLLFARQFKPKISKESEDFIVEQYKH
LRQRDGSGVTKSSWRITVRQLESMIRLSEAMARMHCCDEVQPKHVKEAFRLLNKSIIRVE
TPDVNLDQEEEIQMEVDEGAGGINGHADSPAPVNGINGYNEDINQESAPKASLRLGFSEY
CRISNLIVLHLRKVEEEEDESALKRSELVNWYLKEIESEIDSEEELINKKRIIEKVIHRL
THYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLED

Sequence length

821

Interactions

View interactions

	KEGG		Reactome
	DNA replication Cell cycle		Activation of ATR in response to replication stress Assembly of the pre-replicative complex Orc1 removal from chromatin Activation of the pre-replicative complex Switching of origins to a post-replicative state

Show/Hide Unknown Diseases (17)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Cervical cancer	Likely benign; Benign	rs61750436, rs3087352	RCV005933409 RCV005913141
Clear cell carcinoma of kidney	Benign	rs141448886	RCV005936787
Colon adenocarcinoma	Likely benign	rs61750436	RCV005933407
Familial cancer of breast	Likely benign	rs61750436	RCV005933406
Gastric cancer	Benign; Likely benign	rs141448886, rs61750436, rs3087352	RCV005936789 RCV005933410 RCV005913142
LACTASE PERSISTENCE	Uncertain significance; association; Benign; Likely benign	rs41456145, rs4988235, rs182549, rs145946881, rs41380347, rs41525747, rs55660827	RCV002282970 RCV000008124 RCV000008125 RCV000008126 RCV000008127 RCV000008128 RCV001822870
Lung cancer	Benign; Likely benign	rs141448886, rs61750436	RCV005936793 RCV005933414
Malignant lymphoma, large B-cell, diffuse	Benign	rs141448886	RCV005936788
Malignant tumor of esophagus	Benign; Likely benign	rs141448886, rs61750436	RCV005936786 RCV005933408
MCM6-related disorder	Likely benign; Benign	rs144082863, rs141448886, rs140626674, rs61752701, rs1558754166, rs2289049, rs1381934296, rs746417693, rs61750436, rs201215953, rs3087353, rs188565779, rs201537325	RCV003896613 RCV003909336 RCV003907336 RCV003911728 RCV003967255 RCV003984518 RCV003909864 RCV003924754 RCV003954725 RCV003932137 RCV003982004 RCV003969199 RCV003975560
Melanoma	Benign	rs141448886	RCV005936792
Neurodevelopmental disorder	Uncertain significance	rs2467301834	RCV004586494
Nonpersistence of intestinal lactase	Uncertain significance	rs191517067, rs756704164, rs945901290, rs776037433, rs138808270	RCV003131564 RCV003131565 RCV003132613 RCV000714734 RCV000714680
Ovarian serous cystadenocarcinoma	Benign; Likely benign	rs141448886, rs61750436	RCV005936790 RCV005933411
Thymoma	Likely benign	rs61750436	RCV005933412
Thyroid cancer, nonmedullary, 1	Benign; Likely benign	rs141448886, rs61750436	RCV005936791 RCV005933413
Uterine corpus endometrial carcinoma	Benign	rs3087352	RCV005913143

Show/Hide Text Mining Associations (55)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	31323040, 32121037, 36906970
Autism Spectrum Disorder	Associate	37198333
Bloom Syndrome	Associate	34370039
Bone Diseases Metabolic	Associate	39275317
Breast Neoplasms	Associate	31476594, 31758680, 32830194, 35125121
Breast Neoplasms	Stimulate	37664925
Carcinogenesis	Associate	20648010, 37664925, 39766782
Carcinoma Basal Cell	Stimulate	32830194
Carcinoma Hepatocellular	Associate	29357919, 32082966, 32964028
Carcinoma Hepatocellular	Stimulate	32403044, 35720029
Carcinoma Non Small Cell Lung	Associate	25045014
Carcinoma Renal Cell	Associate	33402477
Carcinoma Squamous Cell	Stimulate	36445337
Colorectal Neoplasms	Associate	30937307, 35496037
COVID 19	Associate	37278873
Developmental Disabilities	Associate	37198333
Diabetes Mellitus	Associate	33577048
Diabetes Mellitus Type 2	Associate	33577048, 39275317
Endocrine System Diseases	Associate	37198333
Epilepsy	Associate	37198333
Esophageal Squamous Cell Carcinoma	Associate	32583000
Growth Disorders	Associate	37198333
Hepatitis B	Associate	31476594, 35125121
Hodgkin Disease	Associate	29202546
Hyperglycemia	Associate	33577048
Hypoxia	Associate	20103649
Irritable Bowel Syndrome	Associate	29912753
Lactase Deficiency Congenital	Associate	20015952, 23029545, 29063188, 30689919, 37354976
Lactose Intolerance	Associate	20225268, 29912753, 32659776, 39275317, 39425916
Lung Neoplasms	Associate	25045014, 35360518
Lymphatic Metastasis	Stimulate	37664925
Lymphoma	Associate	16189522
Lymphoma Mantle Cell	Associate	16189522
Meningioma	Stimulate	19877719
Microcephaly	Associate	37198333
Neoplasm Metastasis	Associate	29357919, 33402477, 33668040
Neoplasms	Associate	22425911, 23874974, 25046975, 29202546, 30150654, 32403044, 32830194, 32964028, 32989049, 33318029, 33402477, 36509991, 37664925, 40007132
Neoplasms	Stimulate	29357919, 32121037, 32583000, 35720029
Neural Tube Defects	Associate	30689919
Neuroblastoma	Associate	24348903
Obesity	Associate	21193851, 33577048
Oligodendroglioma	Associate	31561286
Osteoporosis	Associate	39275317
Osteoporotic Fractures	Associate	39275317
Pancreatic Neoplasms	Associate	27695057
Retinal Dysplasia	Associate	18414413
Retinoblastoma	Associate	33217867
Silicosis	Associate	37278873
Small Cell Lung Carcinoma	Associate	25045014
Thyroid Neoplasms	Associate	37864896
Triple Negative Breast Neoplasms	Associate	31476594, 33668040, 38639528
Urinary Bladder Neoplasms	Associate	18414413
Urogenital Abnormalities	Associate	37198333
Uterine Cervical Dysplasia	Associate	30150654
Uterine Cervical Neoplasms	Associate	23874974, 30150654

MCM6 (minichromosome maintenance complex component 6)