Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4172
Gene name	Minichromosome maintenance complex component 3
Gene symbol	MCM3
Synonyms (NCBI Gene)	HCC5P1-MCM3P1.hRLFB
Chromosome	6
Chromosome location	6p12.2
Summary	The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the

127

Show/Hide all (127)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016314	hsa-miR-193b-3p	Microarray	20304954
MIRT023522	hsa-miR-1-3p	Proteomics	18668040
MIRT024312	hsa-miR-215-5p	Microarray	19074876
MIRT025232	hsa-miR-34a-5p	Proteomics	21566225
MIRT026151	hsa-miR-192-5p	Microarray	19074876
MIRT026151	hsa-miR-192-5p	Sequencing	20371350
MIRT028827	hsa-miR-26b-5p	Microarray	19088304
MIRT049183	hsa-miR-92a-3p	CLASH	23622248
MIRT046726	hsa-miR-222-3p	CLASH	23622248
MIRT044198	hsa-miR-99b-5p	CLASH	23622248
MIRT038726	hsa-miR-93-3p	CLASH	23622248
MIRT052696	hsa-miR-1260b	CLASH	23622248
MIRT052696	hsa-miR-1260b	CLASH	23622248
MIRT054205	hsa-miR-210-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	23028679
MIRT054211	hsa-miR-147a	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	23028679
MIRT054215	hsa-miR-147b	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	23028679
MIRT756223	hsa-miR-4270	Luciferase reporter assayWestern blottingqRT-PCR	38200573
MIRT1137659	hsa-miR-4313	CLIP-seq
MIRT1137660	hsa-miR-4699-3p	CLIP-seq
MIRT1137661	hsa-miR-510	CLIP-seq
MIRT1137662	hsa-miR-512-5p	CLIP-seq
MIRT1137663	hsa-miR-548k	CLIP-seq
MIRT1137664	hsa-miR-548n	CLIP-seq
MIRT1137665	hsa-miR-570	CLIP-seq
MIRT1137659	hsa-miR-4313	CLIP-seq
MIRT1137661	hsa-miR-510	CLIP-seq
MIRT1137662	hsa-miR-512-5p	CLIP-seq
MIRT1137663	hsa-miR-548k	CLIP-seq
MIRT1137664	hsa-miR-548n	CLIP-seq
MIRT2039104	hsa-miR-660	CLIP-seq
MIRT2269102	hsa-miR-1208	CLIP-seq
MIRT2269103	hsa-miR-1238	CLIP-seq
MIRT2269104	hsa-miR-1307	CLIP-seq
MIRT2269105	hsa-miR-141	CLIP-seq
MIRT2269106	hsa-miR-147	CLIP-seq
MIRT2269107	hsa-miR-200a	CLIP-seq
MIRT2269108	hsa-miR-3124-3p	CLIP-seq
MIRT2269109	hsa-miR-3153	CLIP-seq
MIRT2269110	hsa-miR-3201	CLIP-seq
MIRT2269111	hsa-miR-3911	CLIP-seq
MIRT2269112	hsa-miR-3940-5p	CLIP-seq
MIRT2269113	hsa-miR-4261	CLIP-seq
MIRT756223	hsa-miR-4270	CLIP-seq
MIRT2269114	hsa-miR-4272	CLIP-seq
MIRT2269115	hsa-miR-4279	CLIP-seq
MIRT1137659	hsa-miR-4313	CLIP-seq
MIRT2269116	hsa-miR-433	CLIP-seq
MIRT2269117	hsa-miR-4441	CLIP-seq
MIRT2269118	hsa-miR-4452	CLIP-seq
MIRT2269119	hsa-miR-4475	CLIP-seq
MIRT2269120	hsa-miR-4507	CLIP-seq
MIRT2269121	hsa-miR-4638-5p	CLIP-seq
MIRT2269122	hsa-miR-4668-5p	CLIP-seq
MIRT1137660	hsa-miR-4699-3p	CLIP-seq
MIRT2269123	hsa-miR-4782-5p	CLIP-seq
MIRT2269124	hsa-miR-4791	CLIP-seq
MIRT1137661	hsa-miR-510	CLIP-seq
MIRT1137662	hsa-miR-512-5p	CLIP-seq
MIRT2269125	hsa-miR-543	CLIP-seq
MIRT1137663	hsa-miR-548k	CLIP-seq
MIRT1137664	hsa-miR-548n	CLIP-seq
MIRT2269126	hsa-miR-548u	CLIP-seq
MIRT1137665	hsa-miR-570	CLIP-seq
MIRT2269127	hsa-miR-599	CLIP-seq
MIRT2269128	hsa-miR-629	CLIP-seq
MIRT2269129	hsa-miR-644	CLIP-seq
MIRT2269130	hsa-miR-664	CLIP-seq
MIRT2269131	hsa-miR-885-3p	CLIP-seq
MIRT2390710	hsa-miR-106a	CLIP-seq
MIRT2390711	hsa-miR-106b	CLIP-seq
MIRT2390712	hsa-miR-17	CLIP-seq
MIRT2390713	hsa-miR-20a	CLIP-seq
MIRT2390714	hsa-miR-20b	CLIP-seq
MIRT2390715	hsa-miR-302a	CLIP-seq
MIRT2390716	hsa-miR-302b	CLIP-seq
MIRT2390717	hsa-miR-302c	CLIP-seq
MIRT2390718	hsa-miR-302d	CLIP-seq
MIRT2390719	hsa-miR-302e	CLIP-seq
MIRT2390720	hsa-miR-3194-3p	CLIP-seq
MIRT2390721	hsa-miR-372	CLIP-seq
MIRT2390722	hsa-miR-373	CLIP-seq
MIRT2390723	hsa-miR-4434	CLIP-seq
MIRT2390724	hsa-miR-4516	CLIP-seq
MIRT2390725	hsa-miR-4531	CLIP-seq
MIRT2390726	hsa-miR-516b	CLIP-seq
MIRT2390727	hsa-miR-519d	CLIP-seq
MIRT2390728	hsa-miR-520a-3p	CLIP-seq
MIRT2390729	hsa-miR-520b	CLIP-seq
MIRT2390730	hsa-miR-520c-3p	CLIP-seq
MIRT2390731	hsa-miR-520d-3p	CLIP-seq
MIRT2390732	hsa-miR-520e	CLIP-seq
MIRT2390733	hsa-miR-520g	CLIP-seq
MIRT2390734	hsa-miR-520h	CLIP-seq
MIRT2390735	hsa-miR-93	CLIP-seq
MIRT2269103	hsa-miR-1238	CLIP-seq
MIRT2568374	hsa-miR-217	CLIP-seq
MIRT2269108	hsa-miR-3124-3p	CLIP-seq
MIRT2568375	hsa-miR-3140-5p	CLIP-seq
MIRT2568376	hsa-miR-338-5p	CLIP-seq
MIRT2568377	hsa-miR-3907	CLIP-seq
MIRT2269115	hsa-miR-4279	CLIP-seq
MIRT2568378	hsa-miR-4418	CLIP-seq
MIRT2269118	hsa-miR-4452	CLIP-seq
MIRT2568379	hsa-miR-4539	CLIP-seq
MIRT2568380	hsa-miR-4666-3p	CLIP-seq
MIRT2568381	hsa-miR-4680-5p	CLIP-seq
MIRT2568382	hsa-miR-509-3-5p	CLIP-seq
MIRT2568383	hsa-miR-509-5p	CLIP-seq
MIRT1137662	hsa-miR-512-5p	CLIP-seq
MIRT2568384	hsa-miR-518a-5p	CLIP-seq
MIRT2568385	hsa-miR-527	CLIP-seq
MIRT2269125	hsa-miR-543	CLIP-seq
MIRT2568386	hsa-miR-548q	CLIP-seq
MIRT2568387	hsa-miR-582-3p	CLIP-seq
MIRT2039104	hsa-miR-660	CLIP-seq
MIRT2269131	hsa-miR-885-3p	CLIP-seq
MIRT2269103	hsa-miR-1238	CLIP-seq
MIRT2269108	hsa-miR-3124-3p	CLIP-seq
MIRT2568375	hsa-miR-3140-5p	CLIP-seq
MIRT2269115	hsa-miR-4279	CLIP-seq
MIRT2269116	hsa-miR-433	CLIP-seq
MIRT2568379	hsa-miR-4539	CLIP-seq
MIRT2568381	hsa-miR-4680-5p	CLIP-seq
MIRT1137662	hsa-miR-512-5p	CLIP-seq
MIRT2269125	hsa-miR-543	CLIP-seq
MIRT2039104	hsa-miR-660	CLIP-seq
MIRT2269131	hsa-miR-885-3p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
MYCN	Activation	17826980

Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000727	Process	Double-strand break repair via break-induced replication	IBA
GO:0000781	Component	Chromosome, telomeric region	HDA	19135898
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	1549468
GO:0003697	Function	Single-stranded DNA binding	IBA
GO:0004386	Function	Helicase activity	IEA
GO:0005515	Function	Protein binding	IPI	12364596, 15232106, 16899510, 17296731, 19150984, 19862764, 22540012, 24299456, 25036637, 26167883, 26496610, 28514442, 29395061, 31467278, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	20531406, 21383955, 22474384
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005658	Component	Alpha DNA polymerase:primase complex	TAS	1549468
GO:0005694	Component	Chromosome	IEA
GO:0005730	Component	Nucleolus	IDA	21383955
GO:0005737	Component	Cytoplasm	IEA
GO:0006260	Process	DNA replication	IDA	22474384
GO:0006260	Process	DNA replication	IEA
GO:0006270	Process	DNA replication initiation	IEA
GO:0006270	Process	DNA replication initiation	TAS	1549468
GO:0006271	Process	DNA strand elongation involved in DNA replication	IBA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016787	Function	Hydrolase activity	IEA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0017116	Function	Single-stranded DNA helicase activity	IBA
GO:0030174	Process	Regulation of DNA-templated DNA replication initiation	NAS	30069701
GO:0042555	Component	MCM complex	IBA
GO:0042555	Component	MCM complex	IDA	17296731
GO:0042555	Component	MCM complex	IEA
GO:0042555	Component	MCM complex	IPI	22540012
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	20531406
GO:0071162	Component	CMG complex	IPI	22474384
GO:0071162	Component	CMG complex	ISS
GO:1902975	Process	Mitotic DNA replication initiation	IBA

MIM	HGNC	e!Ensembl
602693	6945	ENSG00000112118

P25205

Protein name

DNA replication licensing factor MCM3 (EC 3.6.4.12) (DNA polymerase alpha holoenzyme-associated protein P1) (P1-MCM3) (RLF subunit beta) (p102)

Protein function

Acts as a component of the MCM2-7 complex (MCM complex) which is the replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. Core component of CDC45-MCM-GINS (CMG) helicase, the mol

PDB

6XTX , 6XTY , 7PFO , 7PLO , 7W1Y , 7W68 , 8B9D , 8RWV , 8S09 , 8S0A , 8S0B , 8S0D , 8S0E , 8S0F , 8W0E , 8W0F , 8W0G , 8W0I , 9CAQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14551	MCM_N	13 → 158	MCM N-terminal domain	Domain
PF17207	MCM_OB	110 → 245	MCM OB domain	Domain
PF00493	MCM	280 → 505	MCM P-loop domain	Domain
PF17855	MCM_lid	566 → 653	MCM AAA-lid domain	Domain

Sequence

MAGTVVLDDVELREAQRDYLDFLDDEEDQGIYQSKVRELISDNQYRLIVNVNDLRRKNEK
RANRLLNNAFEELVAFQRALKDFVASIDATYAKQYEEFYVGLEGSFGSKHVSPRTLTSCF
LSCVVCVEGIVTKCSLVRPKVVRSVHYCPATKKTIERRYSDLTTLVAFPSSSVYPTKDEE
NNPLETEYGLSVYKDHQTITIQEMPEKAPAGQLPRSVDVILDDDLVDKAKPGDRVQVVGT
YRCLPGKKGGYTSGTFRTVLIACNVKQMSKDAQPSFSAEDIAKIKKFSKTRSKDIFDQLA
KSLAPSIHGHDYVKKAILCLLLGGVERDLENGSHIRGDINILLIGDPSVAKSQLLRYVLC
TAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRT
AIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFD
LLFIMLDQMDPEQDREISDHVLRMHRYRAPGEQDGDAMPLGSAVDILATDDPNFSQEDQQ
DTQIYEKHDNLLHGTKKKKEKMVSAAFMKKYIHVAKIIKPVLTQESATYIAEEYSRLRSQ
DSMSSDTARTSPVTARTLETLIRLATAHAKARMSKTVDLQDAEEAVELVQYAYFKKVLEK
EKKRKKRSEDESETEDEEEKSQEDQEQKRKRRKTRQPDAKDGDSYDPYDFSDTEEEMPQV
HTPKTADSQETKESQKVELSESRLKAFKVALLDVFREAHAQSIGMNRLTESINRDSEEPF
SSVEIQAALSKMQDDNQVMVSEGIIFLI

Sequence length

808

Interactions

View interactions

	KEGG		Reactome
	DNA replication Cell cycle		Activation of ATR in response to replication stress Assembly of the pre-replicative complex Orc1 removal from chromatin Activation of the pre-replicative complex Switching of origins to a post-replicative state

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Cervical cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EAR, PATELLA, SHORT STATURE SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Meier-Gorlin syndrome	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL ARTERIAL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (48)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	26840709, 31323040, 31545501	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma Pleomorphic	Associate	23886132, 26790448	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Insufficiency	Associate	33654309	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Associate	30413320	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Associate	26823641	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Stimulate	25046975	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Associate	25809478	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	23098454	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	20648010, 24386425, 38200573, 39766782	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Associate	28547962	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Associate	23886132, 26790448	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Stimulate	30363964	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	31737652, 32213663, 32964028	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Stimulate	23886132	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Associate	26790448	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Papillary Follicular	Associate	23821456	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	37464398	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Associate	36445337	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosome Aberrations	Associate	34193281	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	30937307, 31949199	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Inhibit	37218575	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Associate	38200573	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Associate	25046975	★★★★★ ★☆☆☆☆ Found in Text Mining only
Goiter Nodular	Associate	23821456	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Associate	14511370	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Associate	34449552	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Associate	33654309	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	35360518	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Associate	24386425	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Non Hodgkin	Associate	34782936	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meier Gorlin syndrome	Associate	33654309	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	22805320	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Associate	19877719	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	22838965, 23886132, 26823641, 30363964, 32830194, 32964028, 32989049, 35537781, 39310930	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Associate	24348903, 33277872	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	22805320, 31703725, 34782936	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	27695057, 39310930	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prodromal Symptoms	Associate	34671420	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Dysplasia	Associate	18414413	★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Associate	23886132	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Associate	29845250	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	24386425	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Intraepithelial Lesions	Associate	37445651	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Associate	23821456	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Associate	37864896	★★★★★ ★☆☆☆☆ Found in Text Mining only
Trisomy 18 Syndrome	Associate	34193281	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	18414413	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Associate	34671420, 37445651	★★★★★ ★☆☆☆☆ Found in Text Mining only

MCM3 (minichromosome maintenance complex component 3)