MCL1 (MCL1 apoptosis regulator, BCL2 family member)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 4170
Gene name MCL1 apoptosis regulator, BCL2 family member
Gene symbol MCL1
Synonyms (NCBI Gene)
BCL2L3EATMCL1-ESMCL1LMCL1SMcl-1TMbcl2-L-3mcl1/EAT
Chromosome 1
Chromosome location 1q21.2
Summary This gene encodes an anti-apoptotic protein, which is a member of the Bcl-2 family. Alternative splicing results in multiple transcript variants. The longest gene product (isoform 1) enhances cell survival by inhibiting apoptosis while the alternatively s
miRNA miRNA information provided by mirtarbase database.
2424
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (2424)
miRTarBase ID miRNA Experiments Reference
MIRT003287 hsa-miR-29b-3p Luciferase reporter assayWestern blotImmunofluorescence 17404574
MIRT003287 hsa-miR-29b-3p Luciferase reporter assayWestern blotImmunofluorescence 17404574
MIRT003260 hsa-miR-133b Western blot 19654003
MIRT003260 hsa-miR-133b Luciferase reporter assay 19654003
MIRT000878 hsa-miR-15a-5p Microarray 18362358
Transcription factors Transcription factors information provided by TRRUST V2 database.
18
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (18)
Transcription factor Regulation Reference
ATF4 Unknown 22128141
ATM Activation 20164679
DDIT3 Unknown 22253918
E2F1 Repression 11705881
ELK1 Unknown 9880563
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
54
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (54)
GO ID Ontology Definition Evidence Reference
GO:0001709 Process Cell fate determination NAS 10837489
GO:0001836 Process Release of cytochrome c from mitochondria IBA
GO:0005515 Function Protein binding IPI 15901672, 16697956, 17097560, 17428862, 17525735, 18040043, 18981409, 19074266, 19605477, 19683529, 19968986, 20023629, 20085765, 21132008, 21139567, 21145489, 21199865, 21454712, 21458670, 21507240, 22277751, 22516262, 23055042, 23245996, 23680104, 24113155, 26431330, 26859456, 270
GO:0005634 Component Nucleus IDA 20467439
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
159552 6943 ENSG00000143384
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q07820
Protein name Induced myeloid leukemia cell differentiation protein Mcl-1 (Bcl-2-like protein 3) (Bcl2-L-3) (Bcl-2-related protein EAT/mcl1) (mcl1/EAT)
Protein function Involved in the regulation of apoptosis versus cell survival, and in the maintenance of viability but not of proliferation. Mediates its effects by interactions with a number of other regulators of apoptosis. Isoform 1 inhibits apoptosis. Isofor
PDB 2KBW , 2MHS , 2NL9 , 2NLA , 2PQK , 3D7V , 3IO9 , 3KJ0 , 3KJ1 , 3KJ2 , 3KZ0 , 3MK8 , 3PK1 , 3TWU , 3WIX , 3WIY , 4BPI , 4BPJ , 4HW2 , 4HW3 , 4HW4 , 4OQ5 , 4OQ6 , 4WGI , 4WMR , 4WMS , 4WMT , 4WMU , 4WMV , 4WMW , 4WMX , 4ZBF , 4ZBI , 5C3F , 5C6H , 5FC4 , 5FDO , 5FDR , 5IEZ , 5IF4 , 5JSB , 5KU9 , 5LOF , 5MES , 5MEV , 5UUM , 5VKC , 5VX2 , 5W89 , 5W8F , 6B4L
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00452 Bcl-2 213 → 312 Apoptosis regulator proteins, Bcl-2 family Family
Sequence 
MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGS
AGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIM
SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE
IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
Sequence length 350
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  PI3K-Akt signaling pathway
Apoptosis
JAK-STAT signaling pathway
MicroRNAs in cancer 		  Interleukin-4 and Interleukin-13 signaling
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
High myopia Uncertain significance rs1186393634 RCV000785738
Show/Hide Text Mining Associations (178)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acute Coronary Syndrome Associate 15547296
Adenocarcinoma Associate 21887682, 31570787, 31601252
Adenocarcinoma Mucinous Associate 12036450
Adenocarcinoma of Lung Associate 32986659, 34685622
Adenoma Stimulate 12036450
Adenoma Associate 21151390
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis Associate 22403660
Arthritis Rheumatoid Associate 19525395, 21923740, 22403660, 36243930
Astrocytoma Associate 9060818
Ataxia Associate 18495871