Gene Gene information from NCBI Gene database.
Entrez ID 4155
Gene name Myelin basic protein
Gene symbol MBP
Synonyms (NCBI Gene)
-
Chromosome 18
Chromosome location 18q23
Summary The protein encoded by the classic MBP gene is a major constituent of the myelin sheath of oligodendrocytes and Schwann cells in the nervous system. However, MBP-related transcripts are also present in the bone marrow and the immune system. These mRNAs ar
miRNA miRNA information provided by mirtarbase database.
310
miRTarBase ID miRNA Experiments Reference
MIRT440269 hsa-miR-127-5p HITS-CLIP 24374217
MIRT440269 hsa-miR-127-5p HITS-CLIP 24374217
MIRT734679 hsa-miR-665 RNA-seqqRT-PCRImmunocytochemistry (ICC)ELISA 31775315
MIRT738748 hsa-miR-759 HITS-CLIP 33718276
MIRT1136004 hsa-miR-1257 CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
3
Transcription factor Regulation Reference
NF1 Unknown 9765312
NFIB Activation 1699939
SOX10 Unknown 11734543
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
41
GO ID Ontology Definition Evidence Reference
GO:0000165 Process MAPK cascade IDA 22524708
GO:0002020 Function Protease binding IEA
GO:0005515 Function Protein binding IPI 17064692, 17174311, 25416956, 28514442, 31515488, 32296183, 32814053, 33961781
GO:0005516 Function Calmodulin binding IEA
GO:0005516 Function Calmodulin binding IPI 19855925
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
159430 6925 ENSG00000197971
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P02686
Protein name Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein)
Protein function The classic group of MBP isoforms (isoform 4-isoform 14) are with PLP the most abundant protein components of the myelin membrane in the CNS. They have a role in both its formation and stabilization. The smaller isoforms might have an important
PDB 1BX2 , 1FV1 , 1HQR , 1K2D , 1YMM , 1ZGL
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01669 Myelin_MBP 149 304 Myelin basic protein Family
Tissue specificity TISSUE SPECIFICITY: MBP isoforms are found in both the central and the peripheral nervous system, whereas Golli-MBP isoforms are expressed in fetal thymus, spleen and spinal cord, as well as in cell lines derived from the immune system. {ECO:0000269|PubMe
Sequence
MGNHAGKRELNAEKASTNSETNRGESEKKRNLGELSRTTSEDNEVFGEADANQNNGTSSQ
DTAVTDSKRTADPKNAWQDAHPADPGSRPHLIRLFSRDAPGREDNTFKDRPSESDELQTI
QEDSAATSESLDVMASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFG
GDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKG
RGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSP
MARR
Sequence length 304
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    EGR2 and SOX10-mediated initiation of Schwann cell myelination