Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4155
Gene name Gene Name - the full gene name approved by the HGNC.
Myelin basic protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MBP
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
18
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
18q23
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by the classic MBP gene is a major constituent of the myelin sheath of oligodendrocytes and Schwann cells in the nervous system. However, MBP-related transcripts are also present in the bone marrow and the immune system. These mRNAs ar
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT440269 hsa-miR-127-5p HITS-CLIP 24374217
MIRT440269 hsa-miR-127-5p HITS-CLIP 24374217
MIRT734679 hsa-miR-665 RNA-seq, qRT-PCR, Immunocytochemistry (ICC), ELISA 31775315
MIRT738748 hsa-miR-759 HITS-CLIP 33718276
MIRT1136004 hsa-miR-1257 CLIP-seq
Transcription factors
Transcription factor Regulation Reference
NF1 Unknown 9765312
NFIB Activation 1699939
SOX10 Unknown 11734543
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000165 Process MAPK cascade IDA 22524708
GO:0002020 Function Protease binding IEA
GO:0005515 Function Protein binding IPI 17064692, 17174311, 25416956, 28514442, 31515488, 32296183, 32814053, 33961781
GO:0005516 Function Calmodulin binding IEA
GO:0005516 Function Calmodulin binding IPI 19855925
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
159430 6925 ENSG00000197971
Protein
UniProt ID P02686
Protein name Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein)
Protein function The classic group of MBP isoforms (isoform 4-isoform 14) are with PLP the most abundant protein components of the myelin membrane in the CNS. They have a role in both its formation and stabilization. The smaller isoforms might have an important
PDB 1BX2 , 1FV1 , 1HQR , 1K2D , 1YMM , 1ZGL
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01669 Myelin_MBP 149 304 Myelin basic protein Family
Tissue specificity TISSUE SPECIFICITY: MBP isoforms are found in both the central and the peripheral nervous system, whereas Golli-MBP isoforms are expressed in fetal thymus, spleen and spinal cord, as well as in cell lines derived from the immune system. {ECO:0000269|PubMe
Sequence
MGNHAGKRELNAEKASTNSETNRGESEKKRNLGELSRTTSEDNEVFGEADANQNNGTSSQ
DTAVTDSKRTADPKNAWQDAHPADPGSRPHLIRLFSRDAPGREDNTFKDRPSESDELQTI
QEDSAATSESLDVMASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFG
GDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKG
RGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSP
MARR
Sequence length 304
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    EGR2 and SOX10-mediated initiation of Schwann cell myelination
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Periodontal Diseases Periodontal disease N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acquired Immunodeficiency Syndrome Associate 15996199
Allergic Fungal Sinusitis Associate 25361058
Alzheimer Disease Associate 19385666, 24586351
Amyotrophic Lateral Sclerosis Associate 29337119
Aortic Aneurysm Thoracic Associate 34469433
Arginine Glycine Amidinotransferase Deficiency Associate 19575800
Arthritis Rheumatoid Associate 21673997
Autism Spectrum Disorder Associate 34948243
Autoimmune Diseases Associate 10716924, 37506490, 7679118, 8967755
Behcet Syndrome Stimulate 27701407