MAZ (MYC associated zinc finger protein)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4150
Gene name Gene Name - the full gene name approved by the HGNC.
MYC associated zinc finger protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MAZ
Synonyms (NCBI Gene) Gene synonyms aliases
PUR1, Pur-1, SAF-1, SAF-2, SAF-3, ZF87, ZNF801, Zif87
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16p11.2
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(665)
miRTarBase ID miRNA Experiments Reference
MIRT019432 hsa-miR-148b-3p Microarray 17612493
MIRT023060 hsa-miR-124-3p Proteomics;Microarray 18668037
MIRT023351 hsa-miR-122-5p Microarray 17612493
MIRT047788 hsa-miR-30d-5p CLASH 23622248
MIRT047310 hsa-miR-181a-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(20)
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 26089202
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 1502157, 25487955
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IDA 25487955
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
600999 6914 ENSG00000103495
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID P56270
Protein name Myc-associated zinc finger protein (MAZI) (Pur-1) (Purine-binding transcription factor) (Serum amyloid A-activating factor-1) (SAF-1) (Transcription factor Zif87) (ZF87) (Zinc finger protein 801)
Protein function Transcriptional regulator, potentially with dual roles in transcription initiation and termination. ; [Isoform 1]: Binds DNA and functions as a transcriptional activator (PubMed:12270922). Binds to two G/A-
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 279 → 301 Zinc finger, C2H2 type Domain
PF13894 zf-C2H2_4 307 → 330 Domain
PF00096 zf-C2H2 337 → 360 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Present in kidney, liver and brain. In the brain, highest levels are found in motor cortex and midfrontal cortex (at protein level). {ECO:0000269|PubMed:10727212}.; TISSUE SPECIFICITY: [Isoform 1]: Expressed in the heart, brain, placen
Sequence 
MFPVFPCTLLAPPFPVLGLDSRGVGGLMNSFPPPQGHAQNPLQVGAELQSRFFASQGCAQ
SPFQAAPAPPPTPQAPAAEPLQVDLLPVLAAAQESAAAAAAAAAAAAAVAAAPPAPAAAS
TVDTAALKQPPAPPPPPPPVSAPAAEAAPPASAATIAAAAATAVVAPTSTVAVAPVASAL
EKKTKSKGPYICALCAKEFKNGYNLRRHEAIHTGAKAGRVPSGAMKMPTMVPLSLLSVPQ
LSGAGGGGGEAGAGGGAAAVAAGGVVTTTASGKRIRKNHACEMCGKAFRDVYHLNRHKLS
HSDEKPYQCPVCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFSRPDHLNSHVRQVH
STERPFKCEKCEAAFATKDRLRAHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQGPHHV
CELCNKGTGEVCPMAAAAAAAAAAAAAAVAAPPTAVGSLSGAEGVPVSSQPLPSQPW
Sequence length 477
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Multiple sclerosis Multiple Sclerosis rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039
View all (4 more)		 27386562
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Multiple Sclerosis Multiple Sclerosis GWAS
Show/Hide Text Mining Associations (24)
Associations from Text Mining
Disease Name Relationship Type References
Alzheimer Disease Associate 39773540
Amyloidosis Associate 12270922
Arthritis Rheumatoid Associate 12270922
Atherosclerosis Associate 12270922, 24819318
Breast Neoplasms Associate 17902047, 21665940, 23926105, 25449683, 27861158, 36737428
Burkitt Lymphoma Associate 11777933
Carcinoma Hepatocellular Associate 18400094, 40038747
Carcinoma Hepatocellular Stimulate 27861158
Carcinoma Renal Cell Associate 36890610
Diabetes Mellitus Associate 11070077