Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4145
Gene name Gene Name - the full gene name approved by the HGNC.	Megakaryocyte-associated tyrosine kinase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MATK
Synonyms (NCBI Gene) Gene synonyms aliases	CHK, CTK, HHYLTK, HYL, HYLTK, Lsk
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19p13.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene has amino acid sequence similarity to Csk tyrosine kinase and has the structural features of the CSK subfamily: SRC homology SH2 and SH3 domains, a catalytic domain, a unique N terminus, lack of myristylation signals, lack

Show/Hide all(5)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017676	hsa-miR-335-5p	Microarray	18185580
MIRT1133694	hsa-miR-3615	CLIP-seq
MIRT1133695	hsa-miR-3909	CLIP-seq
MIRT1133696	hsa-miR-4639-3p	CLIP-seq
MIRT1133697	hsa-miR-4746-5p	CLIP-seq

Show/Hide all(17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	TAS	7530249
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IBA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	12122014, 16273093, 22939624, 24510904, 24728074, 24947832, 32814053, 36931259
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0006468	Process	Protein phosphorylation	TAS	7530249
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	8999872
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA

MIM	HGNC	e!Ensembl
600038	6906	ENSG00000007264

Protein

UniProt ID

P42679

Protein name

Megakaryocyte-associated tyrosine-protein kinase (EC 2.7.10.2) (CSK homologous kinase) (CHK) (Hematopoietic consensus tyrosine-lacking kinase) (Protein kinase HYL) (Tyrosine-protein kinase CTK)

Protein function

Could play a significant role in the signal transduction of hematopoietic cells. May regulate tyrosine kinase activity of SRC-family members in brain by specifically phosphorylating their C-terminal regulatory tyrosine residue which acts as a ne

PDB

1JWO , 1X6G , 3US4

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00018	SH3_1	59 → 100	SH3 domain	Domain
PF00017	SH2	122 → 196	SH2 domain	Domain
PF07714	PK_Tyr_Ser-Thr	235 → 478	Protein tyrosine and serine/threonine kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in various myeloid cell lines, detected in brain and lung.

Sequence

MAGRGSLVSWRAFHGCDSAEELPRVSPRFLRAWHPPPVSARMPTRRWAPGTQCITKCEHT
RPKPGELAFRKGDVVTILEACENKSWYRVKHHTSGQEGLLAAGALREREALSADPKLSLM
PWFHGKISGQEAVQQLQPPEDGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTI
DEAVFFCNLMDMVEHYSKDKGAICTKLVRPKRKHGTKSAEEELARAGWLLNLQHLTLGAQ
IGEGEFGAVLQGEYLGQKVAVKNIKCDVTAQAFLDETAVMTKMQHENLVRLLGVILHQGL
YIVMEHVSKGNLVNFLRTRGRALVNTAQLLQFSLHVAEGMEYLESKKLVHRDLAARNILV
SEDLVAKVSDFGLAKAERKGLDSSRLPVKWTAPEALKHGKFTSKSDVWSFGVLLWEVFSY
GRAPYPKMSLKEVSEAVEKGYRMEPPEGCPGPVHVLMSSCWEAEPARRPPFRKLAEKLAR
ELRSAGAPASVSGQDADGSTSPRSQEP

Sequence length

507

Interactions

View interactions

	KEGG		Reactome
	Neurotrophin signaling pathway		Downregulation of ERBB2 signaling

MATK (megakaryocyte-associated tyrosine kinase)