MATK (megakaryocyte-associated tyrosine kinase)

Gene

• Entrez ID: 4145
• Gene name: Megakaryocyte-associated tyrosine kinase
• Gene symbol: MATK
• Synonyms (NCBI Gene): CHK, CTK, HHYLTK, HYL, HYLTK, Lsk
• Chromosome: 19
• Chromosome location: 19p13.3
• Summary: The protein encoded by this gene has amino acid sequence similarity to Csk tyrosine kinase and has the structural features of the CSK subfamily: SRC homology SH2 and SH3 domains, a catalytic domain, a unique N terminus, lack of myristylation signals, lack

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017676	hsa-miR-335-5p	Microarray	18185580
MIRT1133694	hsa-miR-3615	CLIP-seq
MIRT1133695	hsa-miR-3909	CLIP-seq
MIRT1133696	hsa-miR-4639-3p	CLIP-seq
MIRT1133697	hsa-miR-4746-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	TAS	7530249
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IBA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	12122014, 16273093, 22939624, 24510904, 24728074, 24947832, 32814053, 36931259
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0006468	Process	Protein phosphorylation	TAS	7530249
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	8999872
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA

Other IDs

• MIM: 600038
• HGNC: 6906
• e!Ensembl: ENSG00000007264

Protein

• UniProt ID: P42679
• Protein name: Megakaryocyte-associated tyrosine-protein kinase (EC 2.7.10.2) (CSK homologous kinase) (CHK) (Hematopoietic consensus tyrosine-lacking kinase) (Protein kinase HYL) (Tyrosine-protein kinase CTK)
• Protein function: Could play a significant role in the signal transduction of hematopoietic cells. May regulate tyrosine kinase activity of SRC-family members in brain by specifically phosphorylating their C-terminal regulatory tyrosine residue which acts as a ne
• PDB: 1JWO, 1X6G, 3US4
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00018	SH3_1	59 → 100	SH3 domain	Domain
  PF00017	SH2	122 → 196	SH2 domain	Domain
  PF07714	PK_Tyr_Ser-Thr	235 → 478	Protein tyrosine and serine/threonine kinase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in various myeloid cell lines, detected in brain and lung.
• Sequence:

  MAGRGSLVSWRAFHGCDSAEELPRVSPRFLRAWHPPPVSARMPTRRWAPGTQCITKCEHT
  RPKPGELAFRKGDVVTILEACENKSWYRVKHHTSGQEGLLAAGALREREALSADPKLSLM
  PWFHGKISGQEAVQQLQPPEDGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTI
  DEAVFFCNLMDMVEHYSKDKGAICTKLVRPKRKHGTKSAEEELARAGWLLNLQHLTLGAQ
  IGEGEFGAVLQGEYLGQKVAVKNIKCDVTAQAFLDETAVMTKMQHENLVRLLGVILHQGL
  YIVMEHVSKGNLVNFLRTRGRALVNTAQLLQFSLHVAEGMEYLESKKLVHRDLAARNILV
  SEDLVAKVSDFGLAKAERKGLDSSRLPVKWTAPEALKHGKFTSKSDVWSFGVLLWEVFSY
  GRAPYPKMSLKEVSEAVEKGYRMEPPEGCPGPVHVLMSSCWEAEPARRPPFRKLAEKLAR
  ELRSAGAPASVSGQDADGSTSPRSQEP

• Sequence length: 507

Pathways

KEGG:

Neurotrophin signaling pathway

Reactome:

Downregulation of ERBB2 signaling